KEGG   Bos mutus (wild yak): 102276389
Entry
102276389         CDS       T02919                                 

Gene name
PTPN11
Definition
(RefSeq) protein tyrosine phosphatase, non-receptor type 11
  KO
K07293  tyrosine-protein phosphatase non-receptor type 11 [EC:3.1.3.48]
Organism
bom  Bos mutus (wild yak)
Pathway
bom04014  Ras signaling pathway
bom04072  Phospholipase D signaling pathway
bom04360  Axon guidance
bom04625  C-type lectin receptor signaling pathway
bom04630  JAK-STAT signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom04670  Leukocyte transendothelial migration
bom04722  Neurotrophin signaling pathway
bom04920  Adipocytokine signaling pathway
bom04931  Insulin resistance
bom05168  Herpes simplex virus 1 infection
bom05205  Proteoglycans in cancer
bom05211  Renal cell carcinoma
bom05220  Chronic myeloid leukemia
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102276389 (PTPN11)
   04630 JAK-STAT signaling pathway
    102276389 (PTPN11)
   04072 Phospholipase D signaling pathway
    102276389 (PTPN11)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102276389 (PTPN11)
   04650 Natural killer cell mediated cytotoxicity
    102276389 (PTPN11)
   04670 Leukocyte transendothelial migration
    102276389 (PTPN11)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102276389 (PTPN11)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102276389 (PTPN11)
  09158 Development and regeneration
   04360 Axon guidance
    102276389 (PTPN11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102276389 (PTPN11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102276389 (PTPN11)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    102276389 (PTPN11)
   05211 Renal cell carcinoma
    102276389 (PTPN11)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102276389 (PTPN11)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102276389 (PTPN11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bom01009]
    102276389 (PTPN11)
Enzymes [BR:bom01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     102276389 (PTPN11)
Protein phosphatases and associated proteins [BR:bom01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    102276389 (PTPN11)
SSDB
Motif
Pfam: Y_phosphatase SH2 DSPc Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 102276389
NCBI-ProteinID: XP_005901887
UniProt: A0A6B0R0E7
LinkDB
Position
Un
AA seq 593 aa
MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTG
DYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGK
EAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDAKSKVTHVMIRCQELKYD
VGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETT
DKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEP
VSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEV
ERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRELKLSKVGQGNTERTVWQYHF
RTWPDHGVPSDPGGVLDFLEEVHHKQESIVDAGPVVVHCSAGIGRTGTFIVIDILIDIIR
EKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSKRKGH
EYTNIKYSLTDQASGDQSPLPPCTPTPSCAEMREDNARVYENVGLMQQQKSFR
NT seq 1782 nt   +upstreamnt  +downstreamnt
atgacatcgcggagatggtttcacccaaatatcactggcgtggaggcagaaaacctactg
ttgacaagaggagttgacggcagtttcttggcgaggcccagtaaaagcaaccctggagac
ttcacactttccgttagaagaaatggagctgtcacccacatcaagattcagaacactggt
gattactatgacctgtacggaggagagaaatttgccactttggctgaattggtccagtat
tacatggaacatcacgggcaactaaaagaaaagaatggagatgttattgagctcaaatat
cctctgaactgtgccgatcctacctctgaaaggtggtttcatggacacctctctgggaaa
gaagcagaaaaattattaactgaaaaaggaaaacatggtagctttcttgtgcgcgagagc
cagagccaccctggagattttgttctctctgtccgaactggagatgacaaaggggagagc
aatgatgccaagtctaaagtgacccacgtcatgattcgctgtcaggaactgaaatatgat
gttggtggaggagagcggtttgattctttgacagacctcgtggagcattacaagaagaat
cctatggtagaaacattgggcacagtactacaactcaagcagcccctcaacacaactcgt
atcaatgctgctgaaatagaaagtcgggttcgagaactaagcaaattagctgagaccaca
gataaagtcaaacaaggcttttgggaagaatttgagacactacaacaacaggagtgtaaa
cttctctatagccgaaaagagggtcagaggcaagaaaataaaaacaaaaatagatataag
aacatcctgcccttcgatcacaccagggtcgtcctccatgacggtgatcccaatgagccc
gtttcggattacatcaacgcaaacattatcatgcctgaatttgaaaccaaatgcaacaac
tcaaagcccaaaaagagttacattgccacacaaggctgcctgcagaacaccgtgaatgac
ttctggaggatggtgttccaagagaactcccgagtgattgtcatgacaacgaaagaagtg
gagagaggaaagagtaaatgtgtcaaatactggcctgacgagtatgcactaaaagaatac
ggagtcatgcgcgttaggaacgtcaaggaaagtgccgctcacgactatacgttaagagaa
cttaaactctcgaaggttggacaagggaatacggagagaacggtctggcaataccacttt
cggacctggccggaccacggcgtgcccagtgacccggggggcgtgctggacttcctggag
gaggttcaccacaagcaggagagcattgtggacgcggggcccgtggtggttcactgcagt
gctggaattggccggacagggacgttcattgtgattgatattcttattgacatcatcaga
gagaaaggtgttgactgtgacatcgacgttcccaaaaccattcagatggtgcggtcacag
aggtcagggatggtccagacagaagcacagtaccgattcatctatatggccgtccagcat
tatattgaaacactacagcgcaggattgaagaagagcagaaaagcaagaggaaaggacac
gaatacacaaatattaagtattccctgacggaccaggcaagtggagatcagagtcccctg
ccaccttgtaccccaacaccatcctgtgcagaaatgagagaagataatgccagagtctat
gaaaatgtgggcctgatgcagcagcagaaaagtttcagatga

DBGET integrated database retrieval system