KEGG   Bos mutus (wild yak): 102276653Help
Entry
102276653         CDS       T02919                                 

Gene name
EZH1
Definition
(RefSeq) enhancer of zeste 1 polycomb repressive complex 2 subunit
  KO
K17451  histone-lysine N-methyltransferase EZH1 [EC:2.1.1.43]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    102276653 (EZH1)
Enzymes [BR:bom01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102276653 (EZH1)
Chromosome and associated proteins [BR:bom03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102276653 (EZH1)
   Polycomb group proteins
    PRC2-EZH1 complex
     102276653 (EZH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PRC2_HTH_1 SET EZH2_WD-Binding preSET_CXC
Motif
Other DBs
NCBI-GeneID: 102276653
NCBI-ProteinID: XP_005899242
LinkDB All DBs
Position
Un
AA seq 747 aa AA seqDB search
MDIPNPPTSKCITYWKRKVKSEYMRLRQLKRLQANMGAKALYVANFAKVQEKTQILNEEW
KKLRVQPVQLMKPVSGHPFLKKCTIESIFPGFASQHMLMRSLNTVALVPIMYSWSPLQQN
FMVEDETVLCNIPYMGDEVKEEDETFIEELINNYDGKVHGEEEMIPGSVLISDAVFLELV
DALNQYSDEDEEGHNDTSDGKQDDSKEDLPVTRKRKRHAIEGSKKSSKKQFPNDMIFSAI
ASMFPENGVPDDMKERYRELTEMSDPNALPPQCTPNIDGPNAKSVQREQSLHSFHTLFCR
RCFKYDCFLHPFHATPNVYKRKNKEIKIEPEPCGTDCFLLLEGAKEYAMLHNPRSKCSGR
RRRRHHVVNASCSNTSASAVAETKEGDSDRDTGNDWASSSSEANSRCQTPTKQKASPAPP
QLCVVEAPSEPVEWTGAEESLFRVFHGTYFNNFCSIARLLGTKTCKQVFQFAVKESLILK
LPTDELMNPSQKKKRKHRLWAAHCRKIQLKKDNSSTQVYNYQPCDHPDRPCDSTCPCIMT
QNFCEKFCQCNPDCQNRFPGCRCKTQCNTKQCPCYLAVRECDPDLCLTCGASEHWDCKVV
SCKNCSIQRGLKKHLLLAPSDVAGWGTFIKESVQKNEFISEYCGELISQDEADRRGKVYD
KYMSSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVVMVNGDHRIGIFAKRAIQAG
EELFFDYRYSQADALKYVGIERETDVL
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atggatataccaaatcccccgacgtccaaatgtatcacttattggaagaggaaagttaag
tctgaatacatgcgacttcggcagcttaaacggcttcaggcgaatatgggtgcaaaggct
ctctatgtagcaaattttgcaaaagttcaagaaaaaacccagatcctcaatgaagaatgg
aagaagcttcgtgtccaacctgttcagttaatgaagcctgtgagtgggcatccttttctc
aaaaagtgtaccatagagagcattttcccgggatttgcaagccagcacatgttaatgagg
tctctgaacacagttgccttggttcccatcatgtactcgtggtcccctctccagcagaac
ttcatggtggaagatgagacagttttgtgcaatatcccctacatgggagatgaggtgaaa
gaggaagatgagactttcattgaggaactgatcaataactacgatggcaaagtccacggt
gaagaagagatgattcctggctctgtcctgatcagtgatgctgttttcctggagttggta
gatgctctgaatcaatactcggatgaagatgaagaagggcacaacgacacctcagatgga
aagcaagatgacagcaaagaggatctgccagtaacaagaaagaggaaacgacatgctatt
gaaggcagcaaaaagagttccaagaaacaattcccaaacgacatgatcttcagtgcgatc
gcctcgatgttccctgagaacggtgtcccagacgacatgaaggagaggtaccgagagctc
acagagatgtcagaccccaatgcgctccccccgcagtgcacacccaacatcgacggcccc
aacgccaagtctgtgcagcgggaacagtctctgcactccttccacacactcttctgccgg
cgctgcttcaaatacgactgcttccttcaccctttccatgccacccctaatgtgtataaa
cgcaagaacaaagaaatcaagattgagccagaaccgtgtggcacagactgcttccttctg
ctggaaggagcaaaggagtacgccatgctgcacaaccctcgctccaagtgctccgggcgt
cgccggcgaaggcaccacgtggtcaatgcttcctgctccaacacttcagcctctgctgtg
gctgagaccaaagaaggggacagcgacagggacactggcaatgactgggcctccagttct
tcagaggcaaactctcgctgtcagacgcccacgaaacagaaggcgagtccagccccacct
cagctctgtgtcgtggaagcaccctcagaacctgtggagtggactggggctgaagaatct
ctttttcgagtctttcatggcacctacttcaacaacttctgttcaatagccagacttctg
gggactaagacatgcaagcaggtcttccagtttgcagtcaaagagtcacttatcctgaag
ctgcccacagatgagcttatgaacccctcgcagaagaagaagagaaagcacaggttgtgg
gctgcacactgccggaaaattcagctgaagaaagataactcctccacccaggtgtacaac
taccagccctgcgaccacccggaccgcccctgtgacagcacgtgcccctgcatcatgact
cagaatttctgtgagaagttctgccagtgcaaccccgactgtcagaatcgctttcccggc
tgtcgctgtaagacccagtgcaataccaagcagtgcccatgctacctggcggtgcgcgag
tgtgaccctgacctgtgcctcacctgtggggcctcggagcactgggactgcaaggtggtt
tcctgtaagaactgcagcattcaacgtggcctcaaaaagcacctgctgctggccccctca
gatgtggccggatggggcaccttcattaaggagtctgtgcagaagaatgaattcatttct
gaatactgtggtgagctcatctctcaggatgaggccgatcgacgagggaaggtctatgac
aagtacatgtccagcttcctgttcaacctcaataacgattttgtagtggatgctacccgg
aaaggaaacaaaattcgatttgcaaaccattcggtgaaccccaactgttatgccaaagtg
gtcatggtgaatggggatcatcgaattgggatctttgccaagagggcaattcaagctggc
gaagagctcttctttgattacaggtacagccaagctgatgccctcaagtacgtggggatc
gagcgggagacggatgtcctttag

DBGET integrated database retrieval system