KEGG   Bos mutus (wild yak): 102276698
Entry
102276698         CDS       T02919                                 

Gene name
LYN
Definition
(RefSeq) LYN proto-oncogene, Src family tyrosine kinase
  KO
K05854  tyrosine-protein kinase Lyn [EC:2.7.10.2]
Organism
bom  Bos mutus (wild yak)
Pathway
bom04062  Chemokine signaling pathway
bom04064  NF-kappa B signaling pathway
bom04611  Platelet activation
bom04662  B cell receptor signaling pathway
bom04664  Fc epsilon RI signaling pathway
bom04666  Fc gamma R-mediated phagocytosis
bom04730  Long-term depression
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05169  Epstein-Barr virus infection
bom05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102276698 (LYN)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102276698 (LYN)
   04662 B cell receptor signaling pathway
    102276698 (LYN)
   04664 Fc epsilon RI signaling pathway
    102276698 (LYN)
   04666 Fc gamma R-mediated phagocytosis
    102276698 (LYN)
   04062 Chemokine signaling pathway
    102276698 (LYN)
  09156 Nervous system
   04730 Long-term depression
    102276698 (LYN)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102276698 (LYN)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    102276698 (LYN)
   05169 Epstein-Barr virus infection
    102276698 (LYN)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102276698 (LYN)
Protein kinases [BR:bom01001]
 Non-receptor tyrosine kinases
  SRC family
   102276698 (LYN)
Membrane trafficking [BR:bom04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    102276698 (LYN)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2
Other DBs
NCBI-GeneID: 102276698
NCBI-ProteinID: XP_005889220
UniProt: L8IWY1
LinkDB
Position
Un
AA seq 512 aa
MGCIKSKRKDNLNDDGVDLKTQPVRNTDRTIYVRDPTSNKHQRPVADSQLLPGQRFQTKD
PEEQGDIVIALYPYDGIHPDDLSFKKGEKMKVLEQHGEWWKAKSVLTKKEGFIPSNYVAK
VNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSYSLSVRDYDPVHGDVI
KHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQSDGLCRRLEKACISPKPQKPWDKDAW
EIPRESIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHD
KLVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIER
KNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCF
TIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRMENCPDELYDIMKMCW
KEKAEERPTFDYLQSVLDDFYTATEGQYQQQP
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgggatgtataaagtcaaaaaggaaagacaatctgaatgacgatggagtagatttgaag
acgcaaccagtacgtaatactgaccgaactatttatgtgagagatccaacgtccaataaa
caccaaaggccagttgcagactctcagcttttaccaggacagaggtttcaaactaaagat
ccagaggagcaaggggacatcgtgatcgcattgtatccgtacgatggcatccacccagac
gacttgtccttcaagaaaggggagaagatgaaagtcctggagcagcacggagagtggtgg
aaagccaagtccgttttgacaaagaaagaaggcttcattcccagcaactatgtggccaaa
gtcaacacgttggaaactgaagagtggtttttcaaggatataaccaggaaggatgcagaa
aggcagcttctggccccagggaacagcgctggagctttccttatcagagaaagcgagaca
ttaaaaggaagttactctctgtctgtcagagactatgaccccgtgcacggcgatgtgatt
aagcactacaaaatcagaagtctggacaatgggggttattacatctccccacgaatcact
tttccttgtatcagcgacatgattaagcattatcaaaagcagtcagatggcttgtgccgg
agattggagaaggcgtgcattagccccaaaccacagaagccatgggacaaggatgcctgg
gagatcccccgagagtccatcaagctggtgaaaaggctgggcgccgggcagttcggggaa
gtctggatgggttactataacaacagcaccaaagtggccgtaaaaacactgaagccaggc
acaatgtctgtgcaggcgttcctggaggaggccaacctcatgaagacgctgcagcacgac
aagctggtgcggctgtatgccgtggtcaccagagaggagcccatctacatcatcactgag
tacatggccaagggcagtttgctggatttcctgaagagcgatgaggggggcaaggtgctg
cttccgaagctgattgacttctctgctcagatcgccgagggaatggcgtacatcgagagg
aaaaactacatccacagagacctacgagccgctaatgtgttagtctctgagtctctcatg
tgcaaaatcgcagactttggtcttgctcgagtgattgaagataacgagtacacagccaga
gaaggtgctaagttccccattaagtggacagctccagaagcaatcaacttcggatgtttc
accatcaagtctgacgtgtggtcctttggaattctcctgtacgaaattgtcacctatggg
aaaattccctacccagggagaactaacgcggacgtgatgaccgccctgtcgcagggctac
aggatgccccgcatggagaactgcccagatgagctctacgacatcatgaagatgtgctgg
aaggaaaaggcagaggagaggccaacgtttgactacctacagagcgtgctggacgacttc
tacacggccaccgagggccagtaccagcagcagccttag

DBGET integrated database retrieval system