KEGG   Bos mutus (wild yak): 102277177
Entry
102277177         CDS       T02919                                 

Gene name
CCR8
Definition
(RefSeq) C-C motif chemokine receptor 8
  KO
K04183  C-C chemokine receptor type 8
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04061  Viral protein interaction with cytokine and cytokine receptor
bom04062  Chemokine signaling pathway
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102277177 (CCR8)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102277177 (CCR8)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    102277177 (CCR8)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102277177 (CCR8)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    102277177 (CCR8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bom04030]
    102277177 (CCR8)
   04050 Cytokine receptors [BR:bom04050]
    102277177 (CCR8)
   04090 CD molecules [BR:bom04090]
    102277177 (CCR8)
G protein-coupled receptors [BR:bom04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    102277177 (CCR8)
Cytokine receptors [BR:bom04050]
 Chemokine receptors
  CC Chemokine
   102277177 (CCR8)
CD molecules [BR:bom04090]
 Proteins
  102277177 (CCR8)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 102277177
NCBI-ProteinID: XP_005909714
UniProt: L8HT35
LinkDB
Position
Un
AA seq 352 aa
MDYTPEPNLTTATDFYYPDIYSSPCDGEGRESKLLLAIFYCILFVFGLLGNSLVILVLVA
CKKLRSVTDVYLLNLALSDLLFVFSFPFQTHYQLDQWVFGTIMCKVVSGFYYIGFFSSMF
FITLMSMDRYLAVVHAVYALKVRTISMGTALSLVVWLTALVATSPLLVFYQVASENGILQ
CYSYYNQQTLKWKIFIHFEVNILGLLIPFSILMFCYIRILHQLKSCQNHNKTKAIKLVLI
VVVASLLFWVPFNTVLFLTSLHDMHVLDGCVMSQQLTYATHVTETISFTHCCVNPIIYAF
MGEKFKKHLSELFRKSCSHTLVYIGRQVSREVLEKSSSNQQSSRSSTVDYIL
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggattacacacctgagcccaatttgacaacagcaactgacttctactatcctgacatc
tactcgagcccctgcgatggggaggggagagagagcaagctgcttcttgccatcttctac
tgcatcctgtttgtatttggtcttctgggcaacagcctggtcatcctagtccttgtcgcc
tgcaagaaactgaggagtgtcacggatgtatacctcttgaacctggccctgtctgacctg
ctttttgtcttctccttcccctttcagacccactatcaactggaccagtgggtgttcggg
accataatgtgcaaggtggtctctggcttttattacatcggcttcttcagcagcatgttc
tttataaccctcatgagtatggacaggtacctggcggttgtccatgccgtatatgccttg
aaagtgaggacgatcagcatgggcacagccctgagtctggtggtgtggctgactgccctg
gtggccacgagcccgttactagtgttttaccaagtggcctccgaaaatggcatcctgcag
tgttactcctattacaatcagcagacgctgaagtggaagatcttcatccactttgaagtg
aacatcttaggcctgctgatcccgttcagcatcctgatgttctgctatatccgcatcctg
caccagctgaagagctgccagaaccacaacaagaccaaggccattaagctcgtgctcatc
gtggtggttgcctccctactcttctgggtccctttcaacacggtcctcttcctcacttcc
ctgcatgacatgcacgtcctggatgggtgtgtcatgagccagcagctgacctatgccacg
cacgtcacagagaccatttccttcacccactgctgtgtgaaccctattatctatgcgttc
atgggtgagaaattcaagaaacacctatcagaactatttcggaagagttgcagccacacc
ttagtctacatagggagacaggtctctagggaggtcttggaaaaatcatcctcgaatcag
cagtccagtcgctcctccaccgtagactacattctgtga

DBGET integrated database retrieval system