KEGG   Bos mutus (wild yak): 102277254
Entry
102277254         CDS       T02919                                 

Gene name
RAD51
Definition
(RefSeq) RAD51 recombinase
  KO
K04482  DNA repair protein RAD51
Organism
bom  Bos mutus (wild yak)
Pathway
bom03440  Homologous recombination
bom03460  Fanconi anemia pathway
bom05200  Pathways in cancer
bom05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    102277254 (RAD51)
   03460 Fanconi anemia pathway
    102277254 (RAD51)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102277254 (RAD51)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102277254 (RAD51)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bom04131]
    102277254 (RAD51)
   04121 Ubiquitin system [BR:bom04121]
    102277254 (RAD51)
   03400 DNA repair and recombination proteins [BR:bom03400]
    102277254 (RAD51)
Membrane trafficking [BR:bom04131]
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    102277254 (RAD51)
Ubiquitin system [BR:bom04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    102277254 (RAD51)
DNA repair and recombination proteins [BR:bom03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA complex
     102277254 (RAD51)
    RecA family proteins
     102277254 (RAD51)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     102277254 (RAD51)
SSDB
Motif
Pfam: Rad51 AAA_25 RecA HHH_5 ATPase ssDNA_TraI_N HHH
Other DBs
NCBI-GeneID: 102277254
NCBI-ProteinID: XP_005889008
UniProt: L8J136
LinkDB
Position
Un
AA seq 339 aa
MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKEL
INIKGISEAKADKILTEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETG
SITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGL
SGSDVLDNVAYARGFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSA
RQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRL
YLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggctatgcaaatgcagcttgaagcaaatgcagatacttctgtggaagaagaaagcttt
ggtccacaacctatttcccgactagagcaatgtggtataaatgccaatgatgtgaagaaa
ttggaagaagctggatttcatactgtagaggctgttgcctatgcaccgaagaaggagcta
ataaatattaaggggattagtgaagccaaagctgataaaattctgactgaggcagctaaa
ttagttccaatgggtttcaccactgcaactgagttccaccaaaggcgatctgagatcata
cagattactactggctccaaagaacttgacaaactgcttcaaggaggaattgagactgga
tccatcacagagatgtttggagaattccgaactgggaagacccagatctgtcatacattg
gctgtaacatgccagcttcccattgaccgaggtggaggtgaaggaaaggccatgtacatt
gacaccgaaggtacctttaggccagaacggctgctagcagtggctgagagatatggcctc
tctggcagtgatgtcctggataatgtagcatatgcccgagggttcaacacagaccaccag
acccagctcctttatcaggcatcggccatgatggttgagtccaggtatgcactgctaatt
gtagacagtgccactgccctctacagaacggactattcgggtcgaggtgagctttcagcc
aggcagatgcacttggccaggtttctgcggatgcttttgcgacttgctgatgagtttggt
gtagcagtggtaatcaccaaccaggtggtagcccaagtggatggagcagccatgtttgct
gcagatcctaaaaaacctattggaggaaatatcattgctcacgcctcaacaacaagactg
tacctgcgaaaaggaagaggggaaaccagaatctgcaaaatctatgactctccttgtctt
cctgaagctgaagcaatgtttgccatcaatgcagatggagtgggagatgccaaagactga

DBGET integrated database retrieval system