KEGG   Bos mutus (wild yak): 102277419
Entry
102277419         CDS       T02919                                 

Gene name
PIK3CG
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma
  KO
K21289  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00562  Inositol phosphate metabolism
bom01100  Metabolic pathways
bom04022  cGMP-PKG signaling pathway
bom04062  Chemokine signaling pathway
bom04072  Phospholipase D signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04261  Adrenergic signaling in cardiomyocytes
bom04371  Apelin signaling pathway
bom04611  Platelet activation
bom04725  Cholinergic synapse
bom04921  Oxytocin signaling pathway
bom05132  Salmonella infection
bom05145  Toxoplasmosis
bom05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102277419 (PIK3CG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102277419 (PIK3CG)
   04072 Phospholipase D signaling pathway
    102277419 (PIK3CG)
   04022 cGMP-PKG signaling pathway
    102277419 (PIK3CG)
   04151 PI3K-Akt signaling pathway
    102277419 (PIK3CG)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102277419 (PIK3CG)
   04062 Chemokine signaling pathway
    102277419 (PIK3CG)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102277419 (PIK3CG)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102277419 (PIK3CG)
  09156 Nervous system
   04725 Cholinergic synapse
    102277419 (PIK3CG)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102277419 (PIK3CG)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    102277419 (PIK3CG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102277419 (PIK3CG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bom04131]
    102277419 (PIK3CG)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102277419 (PIK3CG)
Membrane trafficking [BR:bom04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102277419 (PIK3CG)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 102277419
NCBI-ProteinID: XP_005901497
LinkDB
Position
Un
AA seq 1104 aa
MELENHEQPVVLREDNCRRRRRMKPRSTAASMSSMELIPIEFVLPTSQRNTKTPETALLH
VAGHGNVEQMKAQVWLRVLETSVAADFYHRLGPDHFLLLYQKKGQWYEIYDKYQVVQTLD
CLHYWKVLHRSPGQIHLVQRHSPSEETLAFQRQLTALIGYDVTDVSNVHDDELEFTRRRL
VTPRMAEVAGRDPKLYAMHPWVTSKPLPEYLLKKITNNCIFIIIHRSTTSQTIKVSADDT
PGTILQSFFTKMAKKKSLMDIPESQNEQDFVLRVCGRDEYLVGETPIKNFQWVRQCLKNG
EEIHLVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRK
FRVKIRGIDIPVLPRNADLTVFVEANIQYGQQVLCQRRTSPKPFTEEVLWNVWLEFSIKI
KDLPKGALLNLQIYCGKAPALSGKASAETPSPESRGKAQLLYYVNLLLIDHRFLLRHGEY
VLHMWQLSGKGEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPTPDPEG
DRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKDPKAYPKLFSSVKWGQ
QEIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYL
LQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAY
LRGCGTAMLRDFTQQVQVIDMLQKVTIDIKSLSAEKYDVSSQVIFQLKQKLEILQNLNLP
QSFRVPYDPGLKAGTLVIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQ
DMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTG
AFKDEVLSHWLKEKCPIEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMISETGNL
FHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSLHFQKFQDVCVKAYLAL
RHHTNLLIXXXXXXXXXXXXXXQLTSKEDIEYIRDALTVGKSEEDAKKYFLDQIEVCRDK
GWTVQFNWFLHLVLGIKQGEKHSA
NT seq 3315 nt   +upstreamnt  +downstreamnt
atggagctggagaaccatgaacagcctgtggtgctgagagaggacaactgccgcaggcgc
cggaggatgaagccacgcagcacggcggccagcatgtcctccatggagctcatccccatt
gagttcgtgctgcccaccagccaacgcaacaccaagacccccgaaacggcgctgctgcat
gtggccggccacggcaacgtggagcagatgaaggcccaagtgtggctgcgcgtgctggag
accagcgtggccgccgacttctaccacaggctgggcccggaccacttcctcctgctctac
cagaagaaggggcagtggtatgagatctatgacaagtaccaggtggtgcagaccctggac
tgcctgcactactggaaggtgctgcaccggagccccgggcagatccacctggtacagcgg
cactcgccctcagaggagacgctggccttccagcgccagctcactgccctcatcggctac
gatgtcacagatgtcagcaatgtgcacgacgacgagttggagttcacacgccgccgcctg
gtcaccccgcgtatggccgaggtggctggccgcgaccccaagctctatgccatgcacccc
tgggtgacgtctaagcccctccctgagtacctgctaaagaagatcaccaacaactgtatc
ttcatcattattcaccgcagcaccaccagccagaccatcaaggtctcagctgatgatacc
cctggcaccatcctccagagcttctttaccaaaatggccaagaagaagtccctgatggat
atccccgagagccagaacgaacaggactttgtgctgcgtgtctgtggccgcgatgagtac
ctggtgggcgagacgcccatcaaaaactttcagtgggtgcggcagtgccttaagaatggt
gaagagattcacctggtgcttgacactccgccggacccagccctggatgaggtgaggaag
gaagagtggccgctggtggatgactgcaccggagtcactggctaccatgagcagctaacc
atccatgggaaggaccatgagagcgtgttcactgtgtccctgtgggactgtgaccgcaag
ttcagagtcaagatcaggggcatcgatatccccgtcctgccccggaatgcagatctcacg
gtttttgtggaggcaaacatccagtatgggcagcaagtcctttgccaaagaagaaccagc
ccaaaacccttcacggaggaggtgctctggaatgtgtggcttgagttcagtatcaagatc
aaagacttacccaaaggggctctgctcaacctccagatctactgtggcaaagcaccagct
ctgtctggtaaggcctctgcagagactcccagtcccgagtccagaggcaaagctcagctt
ctctactacgtgaacttgctgctcattgaccaccgattcctcctgcgccacggcgagtac
gtgctccacatgtggcagttatctgggaagggggaagaccaagggagcttcaatgcagac
aagctcacatctgccaccaatcccgacaaggaaaactcaatgtccatctccattctcctg
gacaactactgtcaccccatagccttgcctaagcatcagcccacccctgacccggaaggg
gaccgcgtacgagcagaaatgcccaaccaacttcggaagcaactggaggcaatcatagct
actgatccacttaaccctcttactgcggaagacaaagaattgctttggcatttcagatat
gaaagccttaaggatcccaaagcataccctaagctctttagctcagtgaaatggggacag
caagaaattgtggccaaaacatatcaattgttagccagaagggaggtctgggatcaaagt
gctttggatgttggattaacaatgcaactcctagactgcaacttttcggatgaaaacgta
agagccattgcagttcagaaactggagagcttggaagacgatgacgttctgcattacctg
ctccaattggtccaggctgtgaaatttgaaccataccatgacagtgcccttgccagattt
ctgctgaagcgtggtttaagaaacaaaagaattggtcacttcttgttttggttcttgaga
agtgagattgcccagtcgagacactatcagcagaggtttgcagtgatcctggaggcctac
ctgaggggctgtggcacggccatgctacgggacttcactcaacaagtccaagtaatcgac
atgttacaaaaagtcaccattgatattaaatcactctctgccgaaaagtatgacgtcagc
tcccaagttattttccaactaaagcaaaagcttgaaatcctgcagaatttgaatctcccc
caaagctttagagttccatatgaccctggactgaaggcaggcacactggtgattgaaaaa
tgtaaagtgatggcctctaagaaaaaacctctgtggcttgagtttaaatgtgctgaccct
acagctctatcaaatgaaacaattggaattatctttaaacacggtgatgatctacgccaa
gacatgcttattctacagattctacgaatcatggagtccatttgggagactgaatctttg
gatctgtgcctcctgccatatggttgcatttcaactggtgacaaaataggaatgattgag
attgtaaaagatgccacaacgatcgccaaaattcagcaaagcacagtgggcaacacggga
gcctttaaagatgaagtgctgagtcactggctcaaagaaaaatgccctattgaagaaaag
tttcaggcagcggtggagagatttgtttattcctgtgctggctactgtgtggcaaccttt
gttcttgggataggcgacagacacaatgacaatattatgatctcagagacaggaaatcta
tttcatattgactttgggcacattcttgggaattataaaagtttcctgggcattaataaa
gagagagtgccattcgtgctaactccagacttcctgtttgtgatggggacttctggaaag
aagacaagtctacacttccagaaatttcaggatgtgtgcgtcaaggcttacctagccctt
cgtcatcacacaaacctactgatcatnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnncccagttaaccagcaaagaagatattgaatacattcgggatgccctaacagtaggg
aagagcgaggaggatgctaaaaagtattttctggatcagattgaagtttgcagggacaaa
ggatggactgtgcagtttaactggttcctacatcttgttcttggcatcaaacaaggagag
aaacattcagcctaa

KEGG   Bos mutus (wild yak): 102279608
Entry
102279608         CDS       T02919                                 

Gene name
PIK3R6
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 6
  KO
K21290  phosphoinositide-3-kinase regulatory subunit 5/6
Organism
bom  Bos mutus (wild yak)
Pathway
bom04022  cGMP-PKG signaling pathway
bom04062  Chemokine signaling pathway
bom04072  Phospholipase D signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04261  Adrenergic signaling in cardiomyocytes
bom04371  Apelin signaling pathway
bom04611  Platelet activation
bom04725  Cholinergic synapse
bom04921  Oxytocin signaling pathway
bom05145  Toxoplasmosis
bom05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102279608 (PIK3R6)
   04072 Phospholipase D signaling pathway
    102279608 (PIK3R6)
   04022 cGMP-PKG signaling pathway
    102279608 (PIK3R6)
   04151 PI3K-Akt signaling pathway
    102279608 (PIK3R6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102279608 (PIK3R6)
   04062 Chemokine signaling pathway
    102279608 (PIK3R6)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102279608 (PIK3R6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102279608 (PIK3R6)
  09156 Nervous system
   04725 Cholinergic synapse
    102279608 (PIK3R6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    102279608 (PIK3R6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102279608 (PIK3R6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bom04131]
    102279608 (PIK3R6)
Membrane trafficking [BR:bom04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102279608 (PIK3R6)
SSDB
Motif
Pfam: PI3K_1B_p101
Other DBs
NCBI-GeneID: 102279608
NCBI-ProteinID: XP_005907609
LinkDB
Position
Un
AA seq 756 aa
MESSDVELDLQRSVQAVLRELSAQAPALQSNRGMWRWSLHKKVERDPGKSPMLVRILLRE
LEKAESEDARHIIIPLLHTLMYVLTKATGITEELHRRTYAFCTRLLTLPAPYCTIALDCA
IRLKTETAVPGTLYQRLVIAEQNLTSELYPYRERVFLFVDPELVSPSVCSALLLEIEAAS
GQQTPEACMRHVVSHALQAALGEACHAGALQRKLLASSRPALEGYFHAVVTAVEQMAREP
SPSREGHLERLEEIYCSLLGPAVAARGRCGGDSLQDEPLSVPLPSPRITFHLWTDEEQLW
KELVLFLRPQTQLRLSADLEALDLQGLLPDWELARASMLSTDSGIERDLPLGADELLAPG
SPEAERAGLQRKGGIKKRVWPADIVMPGSWDGPPGLHRRTGRPSGDGELLPGVSRLHTAR
VLVLGDDRMLGRLARAYRNLRKRETQRFCLTPRLSLQLYYIPLLAPETSAASRRSELGEL
AAFLGRADPWYEGIVNSLCPTIHKLAEMPLSLDTSQTVDPFILDAITYYVRMGTQPVYFQ
IYTVKIFSGDLSQDPAEDIFLTELKVKIQDSKFPKDSFSPRRRGVAEGPGAELSICYQKA
LLSHRTREVTVSLRATGLVLKTLPASDTEVSGPTLCTPTAAPDTDHMCLKVSVTEIVKTS
NLAGRSFSVVTNTFRTANIQIQSQDRRLLTLLLDKDSCRTYKDVVRFEVAPCPEPCSRTQ
KSKVLGLSSHQQEMERNKAKVKPLLIPINTFSGIVQ
NT seq 2271 nt   +upstreamnt  +downstreamnt
atggagagctcagatgtggagctggatctccagcggagcgtgcaggctgtgctccgagag
ctcagcgcccaggcccctgccctgcagagcaaccgaggcatgtggaggtggtccctgcac
aagaaggttgagcgggatcctgggaagagcccgatgctggtccgcatcctgctcagagag
ctggagaaggcagaaagtgaggacgcccgccacatcatcattcctttgctgcacactcta
atgtacgtgctcactaaggctacaggcatcacagaagagctccaccggagaacatatgcc
ttttgcacgaggttgctgaccctgcccgccccctactgcacgattgccctggactgtgcc
atcaggctgaaaacggagacggcggtcccagggacgctgtaccagaggctggtcattgcc
gagcagaacctgacgagcgagctgtacccctaccgggagagagtgttcctcttcgtggat
cctgagctggtgtctccctccgtgtgcagtgccctgctgctggagatcgaggcggccagc
gggcagcagacgccggaggcctgcatgcgccacgtggtctcccacgccctgcaggcagcg
ctgggggaggcctgccatgcaggcgcgctgcaaaggaagctgctggccagctcccgcccc
gccctggagggctatttccacgccgtggtgacagcagtggagcagatggccagagagccc
agccctagccgagagggccacctggagaggctggaggagatttactgctcgctgctgggg
ccggcggtcgccgccagggggcgctgcggcggtgactccctccaggacgagccgctgagt
gtccctctgcccagcccccgcatcaccttccacctgtggactgacgaggagcagctctgg
aaggaactggtgctcttcctgcgcccgcaaacccagctgcgcctcagtgcagacttggag
gccttggatcttcagggcctcctgccagactgggagttggcccgggcatccatgctgtcc
actgacagtggcatcgagcgggaccttcctctgggggctgacgagctgctggcacctggc
agccccgaggcagagcgagccgggctgcagcgcaaagggggcatcaagaagcgggtgtgg
cccgcggacatcgtgatgcccggcagctgggatgggcccccagggctgcaccggaggacc
ggcagacccagcggggatggggagctgctgcctggcgtctcccggctgcacacagcgcgg
gtactggtgctgggggatgacaggatgctggggcgcctggcccgggcctaccgcaacctc
aggaagcgagagacccagaggttctgcctcaccccccgactcagcctgcagctctactac
atccccctgctggctcccgagacgtctgcggcatccaggcgttcggagctgggagagctg
gccgcgttcctgggccgcgcggacccatggtacgagggcatcgtcaacagcctgtgcccc
accatccacaagctggcagagatgcctctctccctggacacatcccagaccgtagacccc
ttcatcctggatgccatcacctactatgttcgcatgggcacccagcccgtctatttccag
atctacacggtcaagatcttctctggtgatctgagccaagaccctgccgaggacattttc
ctcaccgagctcaaggtcaagatccaagactccaagttccccaaagatagtttttcaccc
cggaggaggggcgtggccgagggtccaggggctgagctctccatctgctaccagaaggcc
ctgctcagccaccggacccgggaggtcaccgtctccctgcgggccaccgggctggtcctg
aagacccttccagccagtgacactgaagtttcagggcccaccctctgcacccctactgct
gcgcccgacacagaccacatgtgcctgaaagttagtgtgacagagattgtgaagacctcc
aacttggcgggaaggtccttctctgtggtgacaaacaccttccggacagccaacatccag
atccagagccaggaccggaggctgctgaccctgttgctggacaaggacagctgccgcacg
tacaaggatgtggtcaggttcgaggttgctccctgtccagagccgtgttccaggacccag
aaatccaaggtgctggggctcagctcccaccagcaggagatggaaaggaacaaagccaag
gttaagcctcttctgatacccatcaacacgttctctggcatcgtccagtga

KEGG   Bos mutus (wild yak): 102282596
Entry
102282596         CDS       T02919                                 

Gene name
PIK3R5
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 5
  KO
K21290  phosphoinositide-3-kinase regulatory subunit 5/6
Organism
bom  Bos mutus (wild yak)
Pathway
bom04022  cGMP-PKG signaling pathway
bom04062  Chemokine signaling pathway
bom04072  Phospholipase D signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04261  Adrenergic signaling in cardiomyocytes
bom04371  Apelin signaling pathway
bom04611  Platelet activation
bom04725  Cholinergic synapse
bom04921  Oxytocin signaling pathway
bom05145  Toxoplasmosis
bom05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102282596 (PIK3R5)
   04072 Phospholipase D signaling pathway
    102282596 (PIK3R5)
   04022 cGMP-PKG signaling pathway
    102282596 (PIK3R5)
   04151 PI3K-Akt signaling pathway
    102282596 (PIK3R5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102282596 (PIK3R5)
   04062 Chemokine signaling pathway
    102282596 (PIK3R5)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102282596 (PIK3R5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102282596 (PIK3R5)
  09156 Nervous system
   04725 Cholinergic synapse
    102282596 (PIK3R5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    102282596 (PIK3R5)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102282596 (PIK3R5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bom04131]
    102282596 (PIK3R5)
Membrane trafficking [BR:bom04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102282596 (PIK3R5)
SSDB
Motif
Pfam: PI3K_1B_p101 BUD22
Other DBs
NCBI-GeneID: 102282596
NCBI-ProteinID: XP_005907621
LinkDB
Position
Un
AA seq 877 aa
MQQGATTCTEDRIQHALERCLHGLSLSRRSTSWSAGLCLNCWSLQELVSRDPGHFLILLE
QILQKTREVQEKGTYDLLAPLALLFYSTVLCTPHFPPDSDLLLKASRTYHRFLTWPVPYC
SICQELLTFIDAELKAPGISYQRLVRAEQGLSTRSHRSSTVTVLLLNPVEVQAEFLAVAN
QLSTPGPSPHSTYTTLLLHAFQATFGPHCDLPGLHCRLQSKTLAELEDIFTETAEAQELA
SGIGDAAEARQWLRTKLQAVGEKAGFPGVLDTTKPGKLRTIPMPVARCYTYSWNQDSFDI
LQEIPGILGDDEDEDGEDEDEYEEEEEEDLDSDRHCAERDSLLSTSSTASRDSTLSLALS
QASGPTLHRQLLTSFVSGLSDGMDSGYVEDSEESSFERPKRPGTQERRGHRRSGQKFNRI
YKLFKSTSQLMLRRDSRALEGGPEGALPLRRAGSLCSPVSPLDGPRPASRAQRSRSLPQA
KLSPPLPGWLLAPASRHQRRRPFLSGDEDPKASTLRVVVFGSDRISGKVARAYSKLRRLE
SNRPLLTRFFKLQFFYVPVKRTGGCTSPASPCQTSPLPADSPRHPSPAELGAAPWGESTN
DISHYLGMLDPWYERNVLGLMHLPPEVLCQQSLKAESRPLEGSPAQLPILADMLLYYCRF
AARPVLLQVYQTELTFITGEKTTEIFIHSLELGHSAATRAIKASGPGSKRLGIDGDREAV
PLTLQIIYSKGAISGRSRWSTMEKVCTSINLSKACRQQEELDSSTEALTLNLTEVVKRQN
PKSKKGFNQITTSQVKVDKVQIIGSNSCPFAVCLDQDERKILQSVVRCEVSPCYKPEKSN
LCPRPQRPSYPPAQGQTTPDLCSLLCLPIMTFSGALP
NT seq 2634 nt   +upstreamnt  +downstreamnt
atgcagcaaggggccacgacatgcacggaggaccgcatccagcacgccctggagcgctgc
ttgcatgggctcagcctcagccgccgctccacctcctggtcagctgggttgtgtctgaac
tgctggagcctgcaggagctggtgagcagggacccgggccacttccttatcctcctggag
cagatcctgcagaagacccgagaggttcaagagaagggcacctatgacctcctggccccc
ctggccctgctgttctactccactgtcctctgtacaccacacttcccgccagactcagac
ctccttctgaaagcatccagaacctaccaccgattcctgacctggcccgttccttactgt
agcatctgccaggaactgctcaccttcatcgatgctgaactgaaggccccaggaatctcc
taccagcgactggtgagggccgagcagggcctgtccactaggagtcaccgcagctccact
gtcactgtgctcttgctgaacccggtggaggtgcaggccgagttcctcgccgtggccaac
cagctgagcacgcccgggccctcgccgcacagcacctacaccaccctgctcctgcacgcc
ttccaggccacctttgggccccactgcgacctgccgggtttgcactgcaggctgcagtcc
aagaccctggccgagcttgaggacatcttcacggagacggcggaggcccaggaactggca
tccggcatcggggatgctgccgaggcccgccagtggctcaggaccaagctgcaggcggtg
ggagagaaagccggcttccctggtgtcctagacaccaccaaacccggcaagctgcgcacc
atccccatgcccgtggccaggtgctacacctacagctggaaccaggacagcttcgacatc
ctgcaggaaataccgggcatcctgggggacgacgaggatgaggacggggaggacgaggac
gagtacgaggaggaggaggaggaggatttggacagcgacaggcactgtgccgagagggac
tctctactctccaccagttccacggcttcccgcgactccaccctgtcccttgccttgtcc
caggcctcaggacccaccctccaccgccagctgctgacctccttcgtgtcgggcctgtct
gacggcatggacagtggctacgtggaggacagtgaggagagctccttcgagaggcccaag
aggcctggcacccaggaacgccggggccatcgcaggtccgggcagaagttcaacaggatc
tataaactcttcaagagcaccagccagctcatgctgcgaagggactcccgggccctggag
ggcggcccagagggcgccctgcccctgcggcgggctggcagcctctgcagccctgtcagc
cccctggatggcccgcggcccgcctcccgagcccagcgctcacgctccctgccccaggca
aaactcagccccccgctgcccggctggctcctggcccccgcctcccgccaccagcgccgc
cgccccttcctgagcggggacgaggaccccaaggcctccacgctgcgagtcgtggtcttc
ggctccgatcggatctcggggaaggtggcccgggcatacagcaaactgcggcggctggag
agcaaccgtccgctcctcacgcggttcttcaagctccagttcttctacgtgcccgtgaag
cggactggtggctgtaccagcccagcttctccatgccagacgtccccactccccgcagac
tccccaaggcaccccagccctgcggagctgggcgcggccccctggggggagagcaccaac
gacatttcccactacctcggcatgctcgacccctggtatgagcgcaacgtgctgggcctc
atgcacctgccccccgaagtcctgtgccagcagtctctgaaggcggagtcccggcccctg
gagggctcccctgcccagctgcccatcctggccgacatgctgctctattactgccgcttc
gctgcccgcccggtgctgctacaggtctatcagaccgagctgaccttcatcaccggggag
aagacgacagagatcttcatccactccctggagctgggtcactctgctgccacgcgtgcc
atcaaggcttcaggtcctggcagcaagcggctgggcatcgacggtgaccgggaggccgtc
ccgctaacactacagattatctacagcaagggggccatcagtggacgcagtcgctggagc
accatggagaaggtctgcacctccatcaacctcagcaaggcctgccggcagcaggaggaa
ttagactcgagcacagaggccctgacgctaaacctgacagaagtggtgaaaaggcagaac
cctaaatctaagaagggcttcaaccagattaccacgtcgcaggtcaaagtggacaaggtg
cagatcatcggctctaacagctgcccctttgccgtgtgcctggaccaggacgagcggaag
atcctgcagagtgtggttaggtgcgaggtctcaccctgctacaagcccgagaagagcaac
ctctgcccccggccccagaggccctcctacccaccggcacaggggcagaccacgcccgac
ctctgctccctgctctgtctgcccatcatgaccttcagcggagctctgccctag

DBGET integrated database retrieval system