KEGG   Bos mutus (wild yak): 102277523
Entry
102277523         CDS       T02919                                 

Definition
(RefSeq) induced myeloid leukemia cell differentiation protein Mcl-1 homolog
  KO
K02539  myeloid leukemia cell differntiation protein MCL-1
Organism
bom  Bos mutus (wild yak)
Pathway
bom04151  PI3K-Akt signaling pathway
bom04210  Apoptosis
bom04630  JAK-STAT signaling pathway
bom05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102277523
   04151 PI3K-Akt signaling pathway
    102277523
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102277523
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    102277523
SSDB
Motif
Pfam: DUF3150
Other DBs
NCBI-GeneID: 102277523
NCBI-ProteinID: XP_005905702
LinkDB
Position
Un
AA seq 166 aa
MVNKHEKILNFTRYERSLVFGIAEEMESPISDAIMSPEEELDGCEPDPLGKRPAALPSTP
PPAEEEEDELYRQSLEIISQYLREQATGAKDAKPLGGSGTTSRKALETLRRVGDGVQRNH
ETAFQGWVCGVLPCRGPRRRHQKCAAGFCRCCRSRSWFGISNKIAF
NT seq 501 nt   +upstreamnt  +downstreamnt
atggtcaataaacatgaaaagatcctcaatttcaccagatacgagagatctctagtgttt
ggtatagctgaagagatggaatccccaatctccgacgccatcatgtcgcccgaagaggag
ctggacgggtgcgagccagaccctctcgggaagcggcctgccgcgctgccctcgacgccg
cccccagcagaggaggaggaggacgagttatatcggcagtccctggagataatctctcag
tacctccgggagcaggcaaccggcgccaaggacgcgaagcccctgggcgggtctgggacc
acaagccggaaggcgttggagaccctgcgccgagtcggggatggggtgcagcgcaaccac
gagacggctttccaaggatgggtttgtggagttcttccatgtagaggacctagaaggcgg
catcagaaatgtgctgctggcttttgcaggtgttgccggagtaggagctggtttggcata
tctaataagatagccttttaa

KEGG   Bos mutus (wild yak): 102283384
Entry
102283384         CDS       T02919                                 

Gene name
MCL1
Definition
(RefSeq) BCL2 family apoptosis regulator
  KO
K02539  myeloid leukemia cell differntiation protein MCL-1
Organism
bom  Bos mutus (wild yak)
Pathway
bom04151  PI3K-Akt signaling pathway
bom04210  Apoptosis
bom04630  JAK-STAT signaling pathway
bom05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102283384 (MCL1)
   04151 PI3K-Akt signaling pathway
    102283384 (MCL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102283384 (MCL1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    102283384 (MCL1)
SSDB
Motif
Pfam: Bcl-2 Arm_3 Bcl-2_3
Other DBs
NCBI-GeneID: 102283384
NCBI-ProteinID: XP_005895051
LinkDB
Position
Un
AA seq 370 aa
MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLAAGKEATARREVGGGEAGTVIGGSA
GPSPPATLAPDARRVARPSPIGAEGPDVTATPTRLLFFAPTRLASPPEEMESPISDAIMS
PEEELDGCEPDPLGKRPAVRPLPLLVGEASNNSPGSDGWLPSTRPPAEEEEDELYRQSLE
IISQYLAEEEEDELYRQSLEIISQYLREQATGAKDAKPLGGSGATSRKALETLRRVGDGV
QRNHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSDGVTNXGRTVTLISFGAFVAKHLKG
INQESCIEPLAESITDVVVRSKRDWIVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAG
VGAGLAYLIR
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgttcggcctcaagagaaacgcagtaatcggactaaacctctattgtgggggagccgga
ttaggacagggcagcggcgcctcctctccgggggggcggcttttggctgcggggaaggag
gccacggcgcggcgagaggtagggggaggggaagccggcacggtgattggcggaagcgcc
ggcccgagccccccggccactcttgcgcccgacgcccggagggtcgcgcggccctcgccc
attggcgccgagggccccgacgtcaccgcgacccccaccagactgctgttcttcgcgccc
acacgcctcgcgtcgccgcctgaagagatggaatccccgatctccgacgccatcatgtcg
cccgaagaggagctggacgggtgcgagccagaccctctcgggaagcggcctgccgtccgg
cctttacctttgttggtcggagaagccagtaacaacagtccaggctcggacggctggctg
ccctcgacgcggcccccagcagaggaggaggaggacgagttatatcggcagtccctggag
attatctctcagtacctcgcagaggaggaggaggacgagttatatcggcagtccctggag
ataatctctcagtacctccgggagcaggcaaccggcgccaaggacgcgaagcccctgggc
gggtctggggccaccagccggaaggcgttggagaccctgcgccgagtcggggatggggtg
cagcgcaaccacgagacggctttccaaggcatgcttcggaaactggacatcaaaaacgaa
gacgatgtcaaatctttgtctcgagtgatggttcatgttttcagtgacggagtaacaaac
nngggcaggactgtgactcttatttcttttggtgcctttgtggccaaacacttgaagggt
ataaatcaagaaagctgcatcgaaccactagcagaaagcatcacagatgttgtcgtaagg
tcaaaacgagactggatagtcaaacaaagaggctgggatgggtttgtggagttcttccat
gtagaggacctagaaggcggcatcagaaatgtgctgctggcttttgcaggtgttgccgga
gtaggagctggtttggcatatctaataagatag

DBGET integrated database retrieval system