KEGG   Bos mutus (wild yak): 102277585
Entry
102277585         CDS       T02919                                 

Gene name
SOS2
Definition
(RefSeq) SOS Ras/Rho guanine nucleotide exchange factor 2
  KO
K03099  son of sevenless
Organism
bom  Bos mutus (wild yak)
Pathway
bom01521  EGFR tyrosine kinase inhibitor resistance
bom01522  Endocrine resistance
bom04010  MAPK signaling pathway
bom04012  ErbB signaling pathway
bom04014  Ras signaling pathway
bom04062  Chemokine signaling pathway
bom04068  FoxO signaling pathway
bom04072  Phospholipase D signaling pathway
bom04150  mTOR signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04510  Focal adhesion
bom04540  Gap junction
bom04630  JAK-STAT signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom04660  T cell receptor signaling pathway
bom04662  B cell receptor signaling pathway
bom04664  Fc epsilon RI signaling pathway
bom04714  Thermogenesis
bom04722  Neurotrophin signaling pathway
bom04810  Regulation of actin cytoskeleton
bom04910  Insulin signaling pathway
bom04912  GnRH signaling pathway
bom04915  Estrogen signaling pathway
bom04917  Prolactin signaling pathway
bom04926  Relaxin signaling pathway
bom04935  Growth hormone synthesis, secretion and action
bom05034  Alcoholism
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05163  Human cytomegalovirus infection
bom05165  Human papillomavirus infection
bom05200  Pathways in cancer
bom05205  Proteoglycans in cancer
bom05206  MicroRNAs in cancer
bom05210  Colorectal cancer
bom05211  Renal cell carcinoma
bom05213  Endometrial cancer
bom05214  Glioma
bom05215  Prostate cancer
bom05220  Chronic myeloid leukemia
bom05221  Acute myeloid leukemia
bom05223  Non-small cell lung cancer
bom05224  Breast cancer
bom05225  Hepatocellular carcinoma
bom05226  Gastric cancer
bom05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102277585 (SOS2)
   04012 ErbB signaling pathway
    102277585 (SOS2)
   04014 Ras signaling pathway
    102277585 (SOS2)
   04630 JAK-STAT signaling pathway
    102277585 (SOS2)
   04068 FoxO signaling pathway
    102277585 (SOS2)
   04072 Phospholipase D signaling pathway
    102277585 (SOS2)
   04151 PI3K-Akt signaling pathway
    102277585 (SOS2)
   04150 mTOR signaling pathway
    102277585 (SOS2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102277585 (SOS2)
   04540 Gap junction
    102277585 (SOS2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102277585 (SOS2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102277585 (SOS2)
   04660 T cell receptor signaling pathway
    102277585 (SOS2)
   04662 B cell receptor signaling pathway
    102277585 (SOS2)
   04664 Fc epsilon RI signaling pathway
    102277585 (SOS2)
   04062 Chemokine signaling pathway
    102277585 (SOS2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102277585 (SOS2)
   04912 GnRH signaling pathway
    102277585 (SOS2)
   04915 Estrogen signaling pathway
    102277585 (SOS2)
   04917 Prolactin signaling pathway
    102277585 (SOS2)
   04926 Relaxin signaling pathway
    102277585 (SOS2)
   04935 Growth hormone synthesis, secretion and action
    102277585 (SOS2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102277585 (SOS2)
  09159 Environmental adaptation
   04714 Thermogenesis
    102277585 (SOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102277585 (SOS2)
   05206 MicroRNAs in cancer
    102277585 (SOS2)
   05205 Proteoglycans in cancer
    102277585 (SOS2)
   05231 Choline metabolism in cancer
    102277585 (SOS2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102277585 (SOS2)
   05225 Hepatocellular carcinoma
    102277585 (SOS2)
   05226 Gastric cancer
    102277585 (SOS2)
   05214 Glioma
    102277585 (SOS2)
   05221 Acute myeloid leukemia
    102277585 (SOS2)
   05220 Chronic myeloid leukemia
    102277585 (SOS2)
   05211 Renal cell carcinoma
    102277585 (SOS2)
   05215 Prostate cancer
    102277585 (SOS2)
   05213 Endometrial cancer
    102277585 (SOS2)
   05224 Breast cancer
    102277585 (SOS2)
   05223 Non-small cell lung cancer
    102277585 (SOS2)
  09165 Substance dependence
   05034 Alcoholism
    102277585 (SOS2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102277585 (SOS2)
   05160 Hepatitis C
    102277585 (SOS2)
   05163 Human cytomegalovirus infection
    102277585 (SOS2)
   05165 Human papillomavirus infection
    102277585 (SOS2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102277585 (SOS2)
   01522 Endocrine resistance
    102277585 (SOS2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:bom04990]
    102277585 (SOS2)
Domain-containing proteins not elsewhere classified [BR:bom04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   102277585 (SOS2)
SSDB
Motif
Pfam: RasGEF RasGEF_N Histone RhoGEF PH PH_19 IQ_SEC7_PH
Other DBs
NCBI-GeneID: 102277585
NCBI-ProteinID: XP_005894342
LinkDB
Position
Un
AA seq 1239 aa
MAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
IGLVSLCEDEPSSSGELNYYDLVRTEIAEERQYLRELNMIIKVFREAFLSDRKLFKPSDI
EKIFSNILDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDI
LSPKFNENFSKLMARPAVALHFQQLKIRSEEHEDRECLNQAITALMNLQGSMDRIYKQYS
PRRRPGDPVCPFYNRQLRSKHLAIKKMNEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGA
KHERHIFLFDGLMISCKPNHSQSRLPGCSSAEYRLKEKFVMRKIQICDKEDTCECKHAFE
LVSKDENSVIYAAKSAEEKNNWMAALISLQYRSTLDRMLDSVLLKEENEQPLRLPSPEVY
RFVVKDSEENIVFEDNLQSRSGIPIIKGGTVVKLIERLTYHMYADPNFVRTFLTTYRSFC
KPQELLSLLIERFEIPEPEPTEADKLALEKGEQPISTDLKRFRKEYVQPVQLRVLNVFRH
WVEHHFYDFERDLELLERLESFISSVRGKAMKKWVESIAKIIKRKKQAQANGISHNITFE
SPPPPIEWHISRPGQFETFDLMTLHPIEIARQLTLLESDLYRKVQPSELVGSVWTKEDKE
INSPNLLKMIRHTTNLTLWFEKCIVEAENFEERVAILSRIIEILQVFQDLNNFNGVLEIV
SAVNSVSVYRLDHTFEALQERKRKILDDAVELSQDHFKKYLVKLKSINPPCVPFFGIYLT
NILKTEEGNNDFLKKKGKDLINFSKRRKVAEITGEIQQYQNQPYCLRIEPEMRRFFENLN
PMGCASEKEFTDYLFNKSLEIEPRNCKQPPRFPRKSAFSLKSPGIRPNTGRHGSTSGTLR
GHPTPLEREPCKISFSRIAETELESTVSAPTSPNTPSTPPVSASSDLSVFLDVDLNSSCG
SNSIFAPVLLPHSKSFFSSCGSLHKLSEEPLIPPPLPPRKKFDQDASNSKGTMKSDDDPP
AIPPRQPPPPKVKPRVPAPAGPFDGPLHSPPPPPPRDPLPDTPPPVPLRPPEHFINCPFT
LQPPPLGHLHRDPDWFRDVSTCPNSPNTPPSTPSPRVPRRCYVLSSSQNNLAHPQAPPVP
PRQNSSPHLPKLPPKTYKRELSHPPVYRLPLLENAETPQ
NT seq 3720 nt   +upstreamnt  +downstreamnt
atggcccaaccaaggactgttcaagatgtggaggaacgagttcaaaagacctttcctcat
ccaattgataaatgggctattgctgatgcacagtctgccatagagaaacgaaaaagaaga
aatcctctcttactgcctgtggacaaaatccatccttcattgaaggaagttttagggtac
aaagtggactaccatgtatccctgtatattgtggctgtgctggagtatatctcagctgat
attttgaaattggctggtaattatgtttttaatatccgacattatgaaatatctcaacaa
gacattaaagtgtcaatgtgtgcagataaggttttgatggacatgtttgatcaggatgac
ataggcttggtttctctttgtgaagatgaacctagttcttcaggcgagttaaactactat
gaccttgttagaactgaaattgcagaagaaagacagtatctacgggaactaaatatgatc
ataaaagtgtttcgagaagcttttctttctgacagaaagctgtttaaaccttctgatatt
gaaaagattttcagtaacattttagatatacatgaattgactgtgaaacttttaggttta
attgaagacacagttgaaatgactgatgaaagtagccctcatcccttagctggcagctgt
tttgaagatctggcagaggagcaagcatttgatccttatgaaacattatcccaggatatt
ctttcaccaaagtttaatgaaaattttagtaagttgatggccagacctgcagtggctcta
cactttcagcaattgaaaatacgtagtgaagagcatgaagacagagaatgtttgaaccaa
gctattactgctctcatgaatctccaaggtagtatggaccgaatttacaagcagtattca
cctagacgccgacctggggatcctgtttgccctttttataatcgtcaattaagaagcaag
cacctggctattaaaaaaatgaatgaaattcagaaaaacatagatggatgggaaggcaaa
gatattggacagtgttgtaatgaatttattatggaaggcccattgacaagaattggtgct
aaacatgaacggcatatttttctctttgatggcttaatgattagctgcaaacccaatcac
agccagtcacgccttccaggatgcagtagtgcagaatacagattaaaagaaaaatttgtc
atgaggaaaatacaaatatgtgataaagaagatacttgtgagtgcaaacatgcttttgaa
ttagtatccaaagatgaaaacagcgtaatatatgctgctaagtctgccgaagagaaaaat
aattggatggcagcacttatttcccttcagtatcgtagtactcttgatcgaatgctagat
tcagtattattgaaggaagaaaatgaacaaccattgagattaccaagtcctgaagtgtat
cgttttgtggtaaaagactctgaggaaaacattgtttttgaagacaacttgcagagtaga
agtggaatccccattattaaaggaggaactgtggtgaaattaattgaaaggctaacatat
catatgtacgcagatcccaattttgttcgtacttttcttactacatatcgttcattttgt
aaaccacaggaattactaagcttactgattgaacgatttgaaattccagagccagaacct
actgaagcagataaattggcgttagaaaaaggcgagcagcccatcagtacagaccttaaa
aggtttcgcaaggaatacgtccaaccagtacaacttagagtcttaaatgtgtttcggcac
tgggttgaacaccatttttatgactttgaaagagacttggagctgcttgaaagactagaa
tccttcatttcaagtgtaagagggaaagctatgaagaaatgggtagagtcaattgctaag
atcatcaagaggaaaaaacaagctcaggcaaatggtataagccataatattacctttgaa
agtccacctccaccaattgaatggcatatcagcagaccaggacagtttgaaacatttgat
ctcatgacacttcatccaatagaaattgcacgtcagctgacccttttggaatctgatctc
tacaggaaagttcaaccttctgaacttgtagggagtgtatggaccaaagaagataaagaa
ataaattctccaaatttattaaaaatgattcgccacaccacaaatctcaccctctggttt
gaaaaatgcattgtggaggcagaaaattttgaggaacgagtggcaatactgagtagaatt
atagaaattctgcaagtttttcaagatttgaataatttcaatggtgtattggagatcgtc
agtgcagtaaattcagtatcagtctatagactagatcatacctttgaggcgttgcaggaa
agaaaaaggaaaattttggatgacgctgtggaattaagtcaagatcattttaaaaaatat
ctagtgaaacttaagtcaatcaatccaccctgtgtgcctttttttggaatatatttaaca
aatatactgaagactgaagaagggaataatgattttttaaaaaagaaagggaaagattta
atcaatttcagtaagaggaggaaagtagctgaaattactggagaaattcagcagtatcaa
aatcaaccttactgtttacggatagaaccagaaatgaggagattctttgaaaaccttaac
cccatgggatgtgcttctgaaaaagagtttacagattatttgttcaacaagtcactagaa
attgaaccccgaaattgcaaacagccacctcgatttcctaggaaatcagctttctcctta
aaatctcctggaataaggcctaatacaggccgacatggctctacctcaggtactttgcga
ggtcacccaacaccattagaaagagaaccgtgtaaaataagctttagtcggattgctgaa
acggagcttgaatctacagtgtcagcaccaacctctccaaatacaccatctaccccacca
gtgtctgcttcttcagaccttagtgtgtttttagatgtggatctcaacagttcctgtgga
agcaatagcatctttgctccagtcctcttgcctcattcaaagtctttcttcagttcgtgt
ggtagtttacataagctaagtgaagagccactgattcctcctccacttccacctcgaaaa
aaatttgatcaggatgcttcaaattccaagggaactatgaaatctgatgatgacccccct
gctattccaccaagacaacctcctcctccaaaggtaaaacccagagttcctgctcccgct
ggtccatttgacgggcctctgcacagtccacctccaccgccgccaagagaccctcttcct
gatacccctccaccggttccacttcggcctccagaacactttataaactgtccgtttacc
cttcagccacctccactgggacatcttcacagagatccagactggttcagagacgttagt
acgtgtccaaattctccgaacactcctcctagcacaccctctccaagggtacctcgtcga
tgctatgtgctcagttctagtcaaaataatcttgctcatcctcaagctccccctgttcca
ccaaggcagaattcaagccctcatctaccaaaactgccaccaaagacttacaaacgggag
ctttcacaccccccagtgtatagactgcctttgttagaaaatgcagaaactcctcaatga

KEGG   Bos mutus (wild yak): 102286943
Entry
102286943         CDS       T02919                                 

Gene name
SOS1
Definition
(RefSeq) SOS Ras/Rac guanine nucleotide exchange factor 1
  KO
K03099  son of sevenless
Organism
bom  Bos mutus (wild yak)
Pathway
bom01521  EGFR tyrosine kinase inhibitor resistance
bom01522  Endocrine resistance
bom04010  MAPK signaling pathway
bom04012  ErbB signaling pathway
bom04014  Ras signaling pathway
bom04062  Chemokine signaling pathway
bom04068  FoxO signaling pathway
bom04072  Phospholipase D signaling pathway
bom04150  mTOR signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04510  Focal adhesion
bom04540  Gap junction
bom04630  JAK-STAT signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom04660  T cell receptor signaling pathway
bom04662  B cell receptor signaling pathway
bom04664  Fc epsilon RI signaling pathway
bom04714  Thermogenesis
bom04722  Neurotrophin signaling pathway
bom04810  Regulation of actin cytoskeleton
bom04910  Insulin signaling pathway
bom04912  GnRH signaling pathway
bom04915  Estrogen signaling pathway
bom04917  Prolactin signaling pathway
bom04926  Relaxin signaling pathway
bom04935  Growth hormone synthesis, secretion and action
bom05034  Alcoholism
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05163  Human cytomegalovirus infection
bom05165  Human papillomavirus infection
bom05200  Pathways in cancer
bom05205  Proteoglycans in cancer
bom05206  MicroRNAs in cancer
bom05210  Colorectal cancer
bom05211  Renal cell carcinoma
bom05213  Endometrial cancer
bom05214  Glioma
bom05215  Prostate cancer
bom05220  Chronic myeloid leukemia
bom05221  Acute myeloid leukemia
bom05223  Non-small cell lung cancer
bom05224  Breast cancer
bom05225  Hepatocellular carcinoma
bom05226  Gastric cancer
bom05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102286943 (SOS1)
   04012 ErbB signaling pathway
    102286943 (SOS1)
   04014 Ras signaling pathway
    102286943 (SOS1)
   04630 JAK-STAT signaling pathway
    102286943 (SOS1)
   04068 FoxO signaling pathway
    102286943 (SOS1)
   04072 Phospholipase D signaling pathway
    102286943 (SOS1)
   04151 PI3K-Akt signaling pathway
    102286943 (SOS1)
   04150 mTOR signaling pathway
    102286943 (SOS1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102286943 (SOS1)
   04540 Gap junction
    102286943 (SOS1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102286943 (SOS1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102286943 (SOS1)
   04660 T cell receptor signaling pathway
    102286943 (SOS1)
   04662 B cell receptor signaling pathway
    102286943 (SOS1)
   04664 Fc epsilon RI signaling pathway
    102286943 (SOS1)
   04062 Chemokine signaling pathway
    102286943 (SOS1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102286943 (SOS1)
   04912 GnRH signaling pathway
    102286943 (SOS1)
   04915 Estrogen signaling pathway
    102286943 (SOS1)
   04917 Prolactin signaling pathway
    102286943 (SOS1)
   04926 Relaxin signaling pathway
    102286943 (SOS1)
   04935 Growth hormone synthesis, secretion and action
    102286943 (SOS1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102286943 (SOS1)
  09159 Environmental adaptation
   04714 Thermogenesis
    102286943 (SOS1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102286943 (SOS1)
   05206 MicroRNAs in cancer
    102286943 (SOS1)
   05205 Proteoglycans in cancer
    102286943 (SOS1)
   05231 Choline metabolism in cancer
    102286943 (SOS1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102286943 (SOS1)
   05225 Hepatocellular carcinoma
    102286943 (SOS1)
   05226 Gastric cancer
    102286943 (SOS1)
   05214 Glioma
    102286943 (SOS1)
   05221 Acute myeloid leukemia
    102286943 (SOS1)
   05220 Chronic myeloid leukemia
    102286943 (SOS1)
   05211 Renal cell carcinoma
    102286943 (SOS1)
   05215 Prostate cancer
    102286943 (SOS1)
   05213 Endometrial cancer
    102286943 (SOS1)
   05224 Breast cancer
    102286943 (SOS1)
   05223 Non-small cell lung cancer
    102286943 (SOS1)
  09165 Substance dependence
   05034 Alcoholism
    102286943 (SOS1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102286943 (SOS1)
   05160 Hepatitis C
    102286943 (SOS1)
   05163 Human cytomegalovirus infection
    102286943 (SOS1)
   05165 Human papillomavirus infection
    102286943 (SOS1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102286943 (SOS1)
   01522 Endocrine resistance
    102286943 (SOS1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:bom04990]
    102286943 (SOS1)
Domain-containing proteins not elsewhere classified [BR:bom04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   102286943 (SOS1)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH PH_19 PH_10 IQ_SEC7_PH PH_13
Other DBs
NCBI-GeneID: 102286943
NCBI-ProteinID: XP_005893828
LinkDB
Position
Un
AA seq 1276 aa
MLCQAQPRSASDVEERVQKSFPHPIDKWAIADAQSAIEKRKRRNPLSLPVEKIHPLLKEV
LGYKIDHQVSVYIVAVLEYISADILKLVGNYVRNIRHYEITKQDIKVAMCADKVLMDMFH
QDVEDINILSLTDEEPSTSGEQTYYDLVKAFMAEIRQYIRELNLIIKVFREPFVSNSKLF
SANDVENIFSRIVDIHELSVKLLGHIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYES
YARDILRPGFHDRFLSQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELL
KQLEEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQL
AIKKMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQ
PRLPGASNAEYRLKEKFFMRKVQINDKDDTNEYKHAFEIILKDENSVIFSAKSAEEKNNW
MAALISLQYRSTLERMLDVTMLQEEKEEQMRLPSADVYRFAEPDSEENIIFEENVQPKAG
IPIIKAGTVIKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLIIERFEIPEPEPTE
ADRIAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDADLLQRMEEF
IGTVRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPTVEWHISRPGHIETFDLL
TLHPIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEK
CIVETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQ
KKILEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLKRHGKELIN
FSKRRKVAEITGEIQQYQNQPYCLRVESDIKRFFENLNPMGNSMEKEFTDYLFNKSLEIE
PRNPKPLPRFPKKYNYPLKSPGVRPSNPRPGTMRHPTPLQQEPRKISYSRIPESETESTA
SAPNSPRTPLTPPPASGASSTTDVCSVFDSDHSSPFHSSSDTVFIQVTLPHGPRSASVSS
ISLTKSTDEVPVPPPVPPRRRPESAPAESSPSKMMSKHLDSPPAIPPRQPTSKAYSPRYS
ISDRTSISDPPESPPLLPPREPVRTPDVFSSSPLHLQPPPLGKKSDHSNAFFPNSPSPFT
PPPPQTPSPHGTRRHLPSPPLTQEVDLHSIAGPPVPPRQSTSQHIPKLPPKTYKREHTHP
SMHRDGPPLLENAHSS
NT seq 3831 nt   +upstreamnt  +downstreamnt
atgctctgccaagctcaacctcgaagtgcttcagatgtagaggaacgtgttcaaaaaagt
ttccctcatccaattgataagtgggcaatagctgatgcccaatcggctattgaaaagagg
aagcgaagaaaccctttatctctcccagtagaaaaaatccatcctttgttaaaggaggtc
ctaggttataaaattgaccaccaggtttctgtttacatagtagcagtattagaatacatt
tctgcagacattttaaagctggtggggaattatgtgcgaaatatacggcattatgaaatt
acaaaacaagatattaaagtggcaatgtgtgctgataaggtattaatggatatgtttcat
caagatgtggaagatataaatatattatctttaactgatgaagagccttccacctcagga
gagcagacttactatgatttggtaaaagcatttatggcagaaattcgacaatacataagg
gaacttaatttaattataaaagtttttagagagccctttgtctccaattcaaaattgttt
tcagctaatgatgtagaaaatatatttagtcgtatagtggatatacatgaacttagtgta
aaattactgggccatatagaagatactgtggaaatgacagatgaaggcagtccccatcca
ttagtaggaagctgctttgaagacttagcggaggaactggcatttgatccatatgaatca
tatgctcgagatattctacgacctggttttcacgatcgtttccttagtcagttatcaaag
cctggagcagcgctctatttgcagtcaataggcgaaggtttcaaagaagctgttcaatat
gttttacccaggctacttctagcccctgtttaccactgtctgcattacttcgaacttctg
aagcagttagaagaaaagagtgaggatcaagaagacaaagaatgtttgaaacaagcaata
acagctttgcttaatgttcagagtggtatggaaaaaatatgttctaaaagtcttgcaaaa
cgaagacttagtgaatctgcatgtcggttttatagtcagcaaatgaaggggaaacaacta
gcaatcaagaaaatgaacgagattcagaagaatattgatggttgggagggaaaagacatt
ggacagtgttgcaatgagtttataatggaaggaactcttacacgtgtaggagccaaacat
gagagacacatatttctctttgatggcttaatgatttgctgtaaatcaaatcatgggcag
ccaagactacctggtgctagcaatgcagaatatcgtcttaaagaaaagttttttatgaga
aaggtacaaattaatgacaaagatgacaccaatgagtacaagcatgcttttgaaataatt
ttaaaagatgaaaatagtgttatattttctgccaagtcagctgaagagaagaacaattgg
atggcagcattgatatctttacagtaccggagtaccctggaaagaatgcttgatgtgacc
atgctgcaggaagaaaaggaggagcagatgaggctccctagtgctgacgtttatagattt
gcagagcctgactctgaagaaaatatcatatttgaagaaaacgtgcagcccaaagctgga
attccaattatcaaggcaggaaccgttattaaacttatagagaggctcacataccacatg
tatgcagatcccaattttgttcggacatttcttacaacatatagatccttttgtaaacct
caagaactactgagtcttataatagaaaggtttgaaattccagagcctgagccaacagaa
gctgatcgcatcgctatagagaatggggatcaacccttgagtgcagaactaaagagattt
agaaaagaatatatacagcctgtgcagctgcgagtattaaatgtatgtcggcactgggta
gagcaccacttctatgattttgaaagagatgcagatcttttgcagcgaatggaggaattt
attggaaccgtaagaggtaaagcaatgaaaaaatgggttgaatccatcactaaaataatc
caaaggaaaaaaattgccagagacaatggaccaggtcataatattacatttcagagttca
cctcctacggttgagtggcatataagcagacctgggcacattgagacttttgacctgctc
accttacacccaatagaaattgctcgacaactcactttacttgaatcagatctatatcga
gctgtacagccatcagaattagttggaagtgtgtggacaaaagaagacaaagaaattaat
tctcctaatcttctgaaaatgatccggcataccactaatctcactctgtggtttgagaaa
tgtattgtagaaactgaaaacttagaagaaagagtagctgtggtgagtcgaataattgag
attctacaagtgttccaagagctcaacaacttcaatggtgttcttgaggttgtcagtgct
atgaactcatcccctgtttacagattagaccacacgtttgagcaaataccaagtcgccaa
aagaaaattttagaagaagctcatgaactaagtgaagatcactataagaaatatttggca
aaactcaggtctattaatccaccatgtgtgcctttctttggaatttatctcactaatatc
ttgaaaacagaagaaggcaaccctgaggtcctaaaacggcatggaaaagagcttataaac
tttagcaaaaggaggaaagtagcagaaataacaggcgagatccagcagtaccaaaatcag
ccttactgtttacgagtagagtcagatatcaaaaggttttttgaaaacttgaatccaatg
ggaaatagcatggaaaaagaatttacggattatcttttcaacaaatccctagaaatagaa
ccacgaaaccctaagcctcttccaagatttccaaaaaaatacaactatcccctaaaatct
cctggtgttcgtccatcaaacccaagaccaggtactatgagacatcccacacctctgcag
caagagccaaggaaaattagttatagtaggatccctgaaagtgaaacagaaagtacagca
tctgcaccaaattctccaaggacaccgttaacacctcctcctgcttctggtgcttctagt
accacagatgtttgcagcgtatttgattctgatcattcaagcccttttcactcaagcagc
gataccgtctttatccaagttacactgccccatggcccaagatctgcttcagtatcatct
ataagtttaaccaagagcactgatgaagtgcctgtcccccctcctgttcctccacgaaga
cggccagagtctgccccagcggaatcttcaccatctaagatgatgtctaagcatttggac
agccccccagcaattcctcctaggcaacccacatcaaaagcctattcaccacggtattca
atatcagaccggacctctatatcagaccctcctgaaagccctcccttattacctccacga
gaacctgtgaggacacctgatgttttctcaagttcaccactacatctccaacctccccct
ctgggcaaaaaaagtgaccatagtaatgccttcttcccaaacagcccctccccctttaca
ccacctcctcctcaaacaccttctcctcatggaacaagaaggcatctgccgtcaccacca
ctgacacaagaagtggacctccattccattgctgggccgcctgttcctccacgacaaagc
acttctcagcatatccctaaactccctccaaaaacttacaaaagggagcacacccacccg
tccatgcacagagacgggccaccactgttggagaatgcccattcttcctga

DBGET integrated database retrieval system