KEGG   Bos mutus (wild yak): 102277590
Entry
102277590         CDS       T02919                                 

Gene name
CACNA1C
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
bom  Bos mutus (wild yak)
Pathway
bom04010  MAPK signaling pathway
bom04020  Calcium signaling pathway
bom04022  cGMP-PKG signaling pathway
bom04024  cAMP signaling pathway
bom04260  Cardiac muscle contraction
bom04261  Adrenergic signaling in cardiomyocytes
bom04270  Vascular smooth muscle contraction
bom04713  Circadian entrainment
bom04720  Long-term potentiation
bom04723  Retrograde endocannabinoid signaling
bom04724  Glutamatergic synapse
bom04725  Cholinergic synapse
bom04726  Serotonergic synapse
bom04727  GABAergic synapse
bom04728  Dopaminergic synapse
bom04742  Taste transduction
bom04911  Insulin secretion
bom04912  GnRH signaling pathway
bom04921  Oxytocin signaling pathway
bom04924  Renin secretion
bom04925  Aldosterone synthesis and secretion
bom04927  Cortisol synthesis and secretion
bom04929  GnRH secretion
bom04930  Type II diabetes mellitus
bom04934  Cushing syndrome
bom04935  Growth hormone synthesis, secretion and action
bom05010  Alzheimer disease
bom05020  Prion disease
bom05022  Pathways of neurodegeneration - multiple diseases
bom05031  Amphetamine addiction
bom05410  Hypertrophic cardiomyopathy
bom05412  Arrhythmogenic right ventricular cardiomyopathy
bom05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102277590 (CACNA1C)
   04020 Calcium signaling pathway
    102277590 (CACNA1C)
   04024 cAMP signaling pathway
    102277590 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    102277590 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102277590 (CACNA1C)
   04929 GnRH secretion
    102277590 (CACNA1C)
   04912 GnRH signaling pathway
    102277590 (CACNA1C)
   04921 Oxytocin signaling pathway
    102277590 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    102277590 (CACNA1C)
   04924 Renin secretion
    102277590 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    102277590 (CACNA1C)
   04927 Cortisol synthesis and secretion
    102277590 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102277590 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    102277590 (CACNA1C)
   04270 Vascular smooth muscle contraction
    102277590 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    102277590 (CACNA1C)
   04727 GABAergic synapse
    102277590 (CACNA1C)
   04725 Cholinergic synapse
    102277590 (CACNA1C)
   04728 Dopaminergic synapse
    102277590 (CACNA1C)
   04726 Serotonergic synapse
    102277590 (CACNA1C)
   04720 Long-term potentiation
    102277590 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    102277590 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    102277590 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102277590 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102277590 (CACNA1C)
   05020 Prion disease
    102277590 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    102277590 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    102277590 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102277590 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102277590 (CACNA1C)
   05414 Dilated cardiomyopathy
    102277590 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102277590 (CACNA1C)
   04934 Cushing syndrome
    102277590 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bom04040]
    102277590 (CACNA1C)
Ion channels [BR:bom04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102277590 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel Glyco_hydro_cc DUF4834
Other DBs
NCBI-GeneID: 102277590
NCBI-ProteinID: XP_005895262
LinkDB
Position
Un
AA seq 2195 aa
MAASIITPFSQCLLILQSLASSQSQGPSYGSPRPAHANMNANAAAGLAPEHIPTPGAALS
WQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPKKQGSTTATRPPRALLCLTLKN
PIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFT
VEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGF
DVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFM
GKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAF
AMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKE
REKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGLDEEKPRNMSMPTSET
ESVNTENVAGGDIEGESCGARLAHSIVETVSSRYWRRWNRFCRRKCRAAVKSSIFYWLVI
FLVFLNTLTIASEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRF
DCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLXXXXXX
XXXXLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSV
MYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEE
EKERKKLARTASPEKKQEVVEKPAVEETKEEKIELKSITADGESPPATKINMDDLQPNEN
EDKSSYPNQETTGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSPSNRFRL
QCHRIVNDSIFTNLILFFILLSSISLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALK
ILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAI
NVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLF
KGKLYTCSDSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTV
STFEGWPELLYRSIDSHTEDKGPIYNYRVEISVFFIIYIIIIAFFMMNIFVGFVIVTFQE
QGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLILL
NTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMVLKLIAFKPKGYFSDPWNVFDFLIV
IGSVIDVILSETNHYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQCSPFMNAEENSRI
SITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFG
KIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPGNSTEG
ETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAE
YDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLF
ALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFL
IQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDLGPEIRRAISGDLTAEEELDKAM
KEAVSAASEDDIFRRAGGLFGNHVGYYPSDGRGAFPQTFTTQRPLHISKAGNSQGDTESP
SHEKLVDSTFTPSSYSSTGSNANINNANNTALGRCPRPALHSGAVSTLEAHGPPLSPAIR
VQEAAWRHSSQRCPSRDSPIAMLCQEEAPGDETCAVHVDENAEHSSEPSLVSTEMLSYQD
DENRQLTPPEEDRRDIRLSPKRGFLRSASLGRRASFHLECLKRQKNPGGDVSQKTVLPLH
LVHHQALAVAGLSPLLQRSHPPGTLPPPRLTPPATPGPAWPPRPVPTLRLEGAESSDKLT
SSFPSIHCDPHIGEPTPCGVVGTPRRARPVSLTVPSPAGPQGRPFHGSASSLVEAVLISE
GLGQFAQDPRFLEATTQELADACDMTIEEMESAADDILSGGAGQSPNGTLLPCANCRDPG
PDRAGGVEDAAWAPSAEPRQGAEEPRDSRAFASGL
NT seq 6588 nt   +upstreamnt  +downstreamnt
atggcggcgagcatcatcaccccattctcgcagtgcctcctaatcctgcagagcctggcc
agcagccagtctcaaggtcccagctatgggagcccgcgcccggctcacgccaacatgaac
gccaacgcggccgcggggctggcacctgagcacatccccacaccaggggccgccctgtcc
tggcaggccgccatcgacgcggcccggcaggccaagctgatgggcagcgctggcaacgcg
accatctccacggtcagctccacgcagcggaaacggcagcagtatgggaagcccaagaag
cagggcagcacgacagccacccgcccgccccgcgccctgctctgcctgaccctaaagaac
cccatccggagggcctgcatcagcatcgtcgagtggaagccatttgaaatcattatttta
ctgactatttttgccaattgtgtggccttagcgatctatattcccttcccagaggacgac
tccaacgccacgaattccaacctggagcgggtggagtatctcttcctcatcatttttact
gtggaagcatttttaaaagtcatagcctacggactcctctttcaccccaacgcttacctc
cgcaatggctggaacttactagactttatcatcgtggttgtcgggcttttcagcgcgatc
ttagagcaagcgaccaaagccgatggggccaacgccctgggagggaagggtgctggattc
gacgtgaaggcgctgagggcgttccgtgtgctacgacccctgcggttggtgtccggggtc
ccgagtctccaggtggtcttgaattccatcatcaaggccatggtgcccctgctgcacatc
gccttgctcgtgctgttcgtcatcatcatctatgccatcatcggcctggagctcttcatg
ggcaagatgcataagacctgctacaaccaggagggcattgcagatgtcccagcagaagac
gacccctcgccctgtgccctggagacaggccacgggcggcagtgccagaatggcacggtg
tgcaaaccaggctgggatggacccaagcacggcatcaccaatttcgacaacttcgccttc
gccatgctgactgtgttccagtgcatcaccatggagggctggaccgacgtcctctactgg
gtcaatgatgccgtgggaagggactggccctggatctattttgtcacattaatcatcata
ggttcattctttgttcttaacttggttctcggtgtccttagcggagagttctccaaagag
cgagagaaggccaaggcccggggagacttccagaagctgcgagagaagcagcagctggag
gaggacctgaagggctacctggactggatcacgcaggccgaggacatcgaccccgagaat
gaggacgagggcctggacgaggagaaaccccgaaacatgagcatgcccaccagtgagacc
gagtctgtcaacaccgaaaacgtggctggaggggacatcgagggagagagctgcggagcc
aggctggctcactccattgtggaaacggtgtcctcccgctactggcgccggtggaatcgg
ttctgcaggaggaagtgccgcgcggccgtgaagtccagcatcttctactggctggtcatc
ttcctggttttcctcaacacactcaccatcgcctccgagcactacaaccagccccactgg
ctcacggaagtccaagacacggccaacaaggcgctgctggccctgttcacggcggagatg
ctgctcaagatgtacagcctgggcctgcaggcctacttcgtgtcgctcttcaaccgcttc
gactgcttcatcgtgtgcggcggcatcctggagaccatcctggtggagaccaagatcatg
tcgccgttgggcatctccgtgctgcgttgcgtgcgcctcctgcggatatttaagatcaca
aggtactggaactccctgagcaacctggtggcatccctgctnnnnnnnnnnnnnnnnnnn
nnnnnnnnnntgctgctgctcttcctcttcatcatcatcttctccctcctggggatgcag
ctctttggggggaagttcaactttgatgagatgcagacccggaggagcacctttgacaac
ttcccacagtccctcctcaccgtgtttcagatcctgaccggggaggactggaattcggtg
atgtatgatgggatcatggcttatggcggcccctcttttccagggatgttagtctgtatt
tacttcatcatcctcttcatctgtggaaattatatcctactgaacgtgttcttggccatt
gctgtggacaacctggctgacgccgaaagcctcacatctgcccagaaggaggaggaagag
gagaaggagaggaagaagctagccaggactgccagcccagagaagaagcaagaggtggta
gagaagccggccgtggaggagaccaaagaggagaaaatcgagctgaaatccatcacggca
gatggagagtccccacccgccaccaagatcaacatggatgacctccagcccaacgagaat
gaggacaagagctcctaccccaaccaggaaaccacaggagaagaggacgaggaggagccc
gagatgcccgtgggcccccgcccgcgccccctctctgagctgcacctgaaggagaaggca
gtgcccatgccggaagccagcgccttcttcatcttcagccccagcaacaggttccgcctc
cagtgccatcgcatcgtcaatgactccatcttcaccaacctgatcctcttcttcatcctg
ctcagcagcatctccctggccgccgaggaccccgtgcagcacacctccttcaggaaccac
attctgttttattttgacattgttttcactaccattttcaccattgagattgccctgaag
atcctaggcaacgcagactatgtcttcactagtatctttaccttagaaattatcctcaag
atgacggcctatggggccttcctgcacaagggctccttctgccgcaactacttcaacatc
ctggacctgctggtggtcagtgtgtccctcatctccttcggcatccagtccagtgccatc
aacgtggtgaagatcctgcgagtcctgagggtgctccggccactaagggccatcaacagg
gccaaggggctgaagcacgtcgtgcagtgcgtgttcgtggccatccgcaccatcgggaac
attgtgatcgtcaccacgctgctccagttcatgttcgcctgcattggggtccagctcttc
aagggaaagctctacacctgttcggacagttccaaacagacagaggctgaatgcaagggg
aactacataacatacaaggatggggaggtggaccaccccatcatccagccccgcagctgg
gagaacagcaagttcgactttgacaatgtcctggcagccatgatggccctgttcaccgtc
tccaccttcgagggatggccagagttgctgtaccgctccatcgactctcacacggaggac
aagggtcccatatacaactaccgcgtggagatctccgtcttcttcatcatctacatcatc
atcattgccttcttcatgatgaacatcttcgtgggtttcgtcatcgtcaccttccaggag
cagggggagcaggaatacaagaactgcgagctggacaagaaccagcggcagtgtgtggag
tatgccctcaaggcccggcccctgcggaggtacatcccgaaaaaccagcaccagtacaag
gtgtggtacgtggtcaactccacctacttcgagtacctgatgttcgttctcattctgctc
aacaccatctgcctggccatgcagcactacggtcagagctgtctgttcaaaatcgccatg
aacatcctcaacatgctcttcaccggcctcttcacagtggagatggtcctgaagctcatc
gccttcaagcccaagggctactttagtgacccctggaatgtctttgacttcctgatcgta
attggcagcgtaattgacgtcattctcagtgagacgaatcactatttctgtgatgcatgg
aacacatttgacgccttgattgttgtgggtagcattgttgatatagccatcaccgaggta
aacccagctgaacatacccaatgctctccctttatgaacgcggaagagaactctcgcatc
tccatcaccttcttccgcctcttccgggtcatgcgtctggtcaagctgctgagccgcggg
gagggcatccggacactgctgtggaccttcatcaagtccttccaggccctaccctatgtg
gccctcctgatcgtgatgctgtttttcatctacgccgtgatcgggatgcaggtgtttggc
aaaattgccctgaatgacacgacagagatcaacaggaacaacaacttccagaccttcccc
caggctgtgctgctcctcttcaggtgcgccactggggaggcctggcaggacatcatgctg
gcctgcatgcctggcaagaagtgcgcgcccgagtcagagccgggcaacagcacagagggg
gagacgccctgtggcagcagcttcgccgtcttctacttcatcagcttctacatgctctgc
gccttcctgatcatcaacctcttcgtagccgtcatcatggacaactttgactacctgacg
agggactggtccatcctgggtccccaccacctggacgaatttaagagaatttgggcagag
tatgaccctgaagccaagggacgcatcaaacacctggatgtggtgaccctgctccgacgg
attcagccccccctgggttttgggaagctgtgccctcaccgcgtggcttgcaaacgcctg
gtctccatgaacatgcccctgaacagcgacgggactgtcatgttcaatgccacgctgttt
gccctggtccgtacggctctgaggatcaagacggaagggaacctggaacaggccaatgag
gagctgcgggccatcatcaagaagatctggaaacggaccagcatgaagctgctggaccaa
gtggtgccgcccgcaggagatgacgaggtcacggtgggcaagttttacgctactttcctg
atccaggagtatttccggaagttcaagaagcgcaaagagcaaggcctggtgggcaagccc
tcccagaggaacgccctgtccctgcaggctggcctgcgcaccctgcacgacctggggccc
gagatccgccgggccatctctggggacctgaccgctgaggaggagctggacaaggccatg
aaggaggctgtgtctgcagcctcagaagatgacatcttcaggagggccggcggcctgttc
ggcaaccacgtgggctactacccgagcgacggccggggcgccttcccccagaccttcacc
acccagcgccccctgcacatcagcaaggcaggcaacagccagggggacaccgagtccccc
tcccacgagaaactggtggactccaccttcacccccagcagctactcatccacaggctcc
aacgccaacatcaacaacgccaacaacaccgccctgggccgctgcccccgccccgctctc
cactccggtgctgtcagcaccttggaggcccacgggccccccttgtcccctgccatccgg
gtgcaggaggccgcgtggaggcacagctcccagaggtgcccctcccgggacagcccgata
gccatgctgtgtcaggaagaggcccctggggacgagacctgtgccgtgcacgtggacgag
aacgcagagcacagcagcgagcccagcttggtctccacggagatgctctcctaccaggat
gacgagaatcggcagctgactccccccgaggaggacaggagggacatccgtctgtcccca
aagaggggcttcctgcgctccgcctccctaggtcgaagggcctccttccaccttgaatgt
ctgaagcgacagaagaatcctgggggagacgtctctcagaagacagtcctgcctttgcac
ctggttcaccatcaggcgctggcagtggcgggtctgagccccctcctgcagagaagccat
ccccctgggaccctccccccaccacgcctcacaccccccgccacacctggcccagcctgg
cctccgcggcctgtgcccaccctgcggctggagggggccgagtccagcgacaagctcacc
agcagcttcccatccatccactgcgacccccacatcggggagcccacgccctgcggggtt
gtcggcaccccccggagggcccggcccgtgtcactcactgtgcccagcccggcagggccc
cagggccgtccgttccatggcagtgccagcagcctggtggaggcggtcttgatctcggaa
ggattggggcagtttgctcaggaccccaggttcctcgaggccaccacgcaggagctggcc
gatgcctgcgacatgaccattgaggagatggagagcgcggctgacgacatcctcagcggg
ggcgccgggcagagccccaacggcaccctgctcccgtgtgcaaactgcagggacccgggg
ccggaccgagcggggggcgtggaggacgcagcctgggcgcccagcgccgagccccgccag
ggcgcagaggagccccgggacagcagggccttcgccagcggcctgtag

DBGET integrated database retrieval system