KEGG   Bos mutus (wild yak): 102277710
Entry
102277710         CDS       T02919                                 

Gene name
STAT2
Definition
(RefSeq) signal transducer and activator of transcription 2
  KO
K11221  signal transducer and activator of transcription 2
Organism
bom  Bos mutus (wild yak)
Pathway
bom04062  Chemokine signaling pathway
bom04217  Necroptosis
bom04380  Osteoclast differentiation
bom04621  NOD-like receptor signaling pathway
bom04625  C-type lectin receptor signaling pathway
bom04630  JAK-STAT signaling pathway
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102277710 (STAT2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102277710 (STAT2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102277710 (STAT2)
   04625 C-type lectin receptor signaling pathway
    102277710 (STAT2)
   04062 Chemokine signaling pathway
    102277710 (STAT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102277710 (STAT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102277710 (STAT2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102277710 (STAT2)
   05160 Hepatitis C
    102277710 (STAT2)
   05171 Coronavirus disease - COVID-19
    102277710 (STAT2)
   05164 Influenza A
    102277710 (STAT2)
   05162 Measles
    102277710 (STAT2)
   05168 Herpes simplex virus 1 infection
    102277710 (STAT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102277710 (STAT2)
   05169 Epstein-Barr virus infection
    102277710 (STAT2)
   05165 Human papillomavirus infection
    102277710 (STAT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bom03000]
    102277710 (STAT2)
Transcription factors [BR:bom03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    102277710 (STAT2)
SSDB
Motif
Pfam: STAT_alpha STAT2_C STAT_bind STAT_int SH2
Other DBs
NCBI-GeneID: 102277710
NCBI-ProteinID: XP_005903495
LinkDB
Position
Un
AA seq 857 aa
MAQWEMLQNLDSPFQDQLHELYSNSLLPMDVRQHLAVWIEDQNWQKAALGNDAAMANMLF
LHFLDQLNSECGRCSQDSEYFLLQHNLRKFYRDIQALPTGSTQLAEMIFNLLLEEKRILT
WAQRAQLEQREPAPEAPGESQQHELDSRILKLQAMKEKLVKSISQLKDQQDVFCFRYNIE
KSVRTPSLDPRQTRQMDILQETLNELDRQRKEVLDASKALLGQLTTLIELLLPKLEEWKV
QQQKACIGAPPVGGLEQLEKWFTDGAKLLFHLRQLLKELKELSHMVSYDGDPLNKGVDLR
EAQVTELLQRLLHRAFVVENQPCMPQTLHRPLILKTGSKFTVRTRLLVRLQEGNESLTAE
VSVDRDSPKSQGFRKFNILTSNQKTLTPEKGQTQGLIWDFGYLTLVEQRSGGSGKGNNKG
LLSVTEELHIISFTVKYTYQGLKQELTTDSLPVVIISNMNQLSIAWASVLWFNLLSSNPQ
DQQFFSNPPKAPWNLLGPALSWQFSSYVNRGLDSDQLGMLRDKLFGQNSKTEGASLSWVD
FIKRESPPGKLPFWTWLDKILDLIHDHLKDLWKDGRIMGFVSRNQVRRLLKKTVSGTFLL
RFSETLEGGITCSWVEHQDDDEVLINSVQPFTKEVLQSLPLTKIISQYQMLTEENIPENP
LRFLYPRIPRDEAFGCYSQEKINPEERKKYLKHKLIFVSNRQVDELQQLPELKLEPELES
LELGLGFTSGPEHGPGLDLEPLLEAGLDLSMEPMLEPTLEPTLGEVSQGVLEPHPGPQLQ
LEPIPELELQPMPEPDLPYDLRHLNTEDMEIFRNSMRIEEIMPNGDPVLPCQNTMDEADV
FNPSHFYADGPLSPSDY
NT seq 2574 nt   +upstreamnt  +downstreamnt
atggcgcagtgggagatgctgcagaaccttgacagcccgtttcaggatcagctgcatgag
ctctactcaaatagcctcctgccgatggatgttcgacagcacttggctgtctggattgaa
gatcagaactggcagaaagctgcactgggaaacgatgctgccatggctaatatgctattc
ttgcacttcttggaccaactcaactctgagtgtggccgatgcagccaagactctgagtat
tttttgctacagcacaacttgcgaaaattctatcgagatattcaggcccttcccactggc
tctacccagttggctgagatgatctttaatctccttctggaagaaaaaagaattctgacc
tgggctcagagggctcagctggagcaacgagagccagcccctgaagcacctggggagagc
cagcagcatgaacttgattcccggatcctgaaattacaggctatgaaggagaagctggtg
aaatccatcagccaactgaaagaccagcaggatgtcttctgtttccgatataatattgag
aaatcagtgaggacaccttctttggacccccgtcagaccagacagatggacattcttcag
gaaacactcaatgaactggacagacagagaaaggaggtgctggatgcctccaaagcactg
ctaggccaattaactaccttaattgagctattgctgcccaagttggaggaatggaaagtc
cagcagcagaaagcctgcattggagcgccccctgtcggagggttggaacagctggagaag
tggttcacagatggagcgaagctgctgtttcacctgcggcagctgctgaaggagctgaag
gagttgagtcacatggtctcctatgatggggaccctctgaacaaaggggtggacctgcgg
gaggcccaggtcacagagctgctgcagcgcctgctccacagagcctttgtagtagaaaat
cagccctgcatgccccaaactcttcatcgacccctcatcctcaagacagggagcaagttc
accgtccgaacaaggctgctagtgagactccaggaaggcaatgaatcactgactgcggaa
gtctccgttgacagggattctcccaaatcacaaggcttccggaagttcaacattctgacc
tcaaaccagaaaactttgacccccgagaaaggccagactcagggcttaatttgggacttt
ggctacctgactctggtggagcagcgttcagggggttcaggaaaaggcaacaataagggg
ctgctgtccgttacagaggaattgcacatcattagcttcacagtcaaatacacctaccag
ggtctgaagcaggagctgacaacggacagcctccctgtggtgattatttctaacatgaac
caactctcaattgcctgggcctctgttctctggttcaatctgctcagctcaaacccccag
gatcagcagttcttctccaaccccccgaaggccccatggaacttgctgggccctgctctc
agttggcaattctcctcctatgttaatcgaggccttgactcagaccagctaggcatgctg
agggacaagctgtttgggcagaactccaagactgagggtgcatcgttgtcctgggttgac
ttcattaagcgagagagtccccctggcaagctaccgttttggacatggctcgacaagatt
ctggacctgatacatgaccacctgaaggatctctggaaggatggacgtatcatgggcttt
gtgagccggaaccaggtgcgccggctgctgaagaagactgtctccggcaccttcctgctg
cgctttagtgaaacgttggaggggggcattacctgctcctgggtggaacaccaagatgat
gacgaggtgctcatcaactctgtgcagcccttcaccaaggaggtgctgcagtcactccca
ctgaccaagatcatcagccagtaccagatgctcacggaggagaacatacctgagaaccca
ctgcgcttcctctacccgagaatcccccgggatgaggcttttggttgctactcccaggag
aaaattaatcctgaggaacggaagaaatacctgaaacataagctcatttttgtctctaac
agacaggtggatgaactgcagcaactgccggagctcaagttggagccagagctggagtca
ttagagctgggtctggggttcacatcagggcctgagcacgggccaggcctggacttagag
ccactgctggaggcaggattggatctgagcatggagcccatgctggagcccacgctggag
cccacactaggcgaggtgtcacagggagtcctagaaccacacccgggaccacaactgcag
ctggagcctattccagagctcgaactacagcccatgccagaaccagatttgccctatgat
ctgagacacttgaacactgaggacatggaaatctttaggaacagcatgaggattgaagaa
atcatgccaaacggtgatccagtgttgccttgccagaacaccatggatgaagctgacgtc
ttcaaccccagccacttctatgcagatgggcccttgagcccttctgactactag

KEGG   Bos mutus (wild yak): 102282282
Entry
102282282         CDS       T02919                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
bom  Bos mutus (wild yak)
Pathway
bom01521  EGFR tyrosine kinase inhibitor resistance
bom04062  Chemokine signaling pathway
bom04066  HIF-1 signaling pathway
bom04068  FoxO signaling pathway
bom04217  Necroptosis
bom04550  Signaling pathways regulating pluripotency of stem cells
bom04630  JAK-STAT signaling pathway
bom04659  Th17 cell differentiation
bom04917  Prolactin signaling pathway
bom04920  Adipocytokine signaling pathway
bom04931  Insulin resistance
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom04935  Growth hormone synthesis, secretion and action
bom05145  Toxoplasmosis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05169  Epstein-Barr virus infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
bom05203  Viral carcinogenesis
bom05205  Proteoglycans in cancer
bom05206  MicroRNAs in cancer
bom05212  Pancreatic cancer
bom05221  Acute myeloid leukemia
bom05223  Non-small cell lung cancer
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bom05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102282282 (STAT3)
   04066 HIF-1 signaling pathway
    102282282 (STAT3)
   04068 FoxO signaling pathway
    102282282 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102282282 (STAT3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102282282 (STAT3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102282282 (STAT3)
   04062 Chemokine signaling pathway
    102282282 (STAT3)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102282282 (STAT3)
   04917 Prolactin signaling pathway
    102282282 (STAT3)
   04935 Growth hormone synthesis, secretion and action
    102282282 (STAT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102282282 (STAT3)
   05206 MicroRNAs in cancer
    102282282 (STAT3)
   05205 Proteoglycans in cancer
    102282282 (STAT3)
   05203 Viral carcinogenesis
    102282282 (STAT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102282282 (STAT3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102282282 (STAT3)
   05221 Acute myeloid leukemia
    102282282 (STAT3)
   05223 Non-small cell lung cancer
    102282282 (STAT3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102282282 (STAT3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102282282 (STAT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102282282 (STAT3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102282282 (STAT3)
   05160 Hepatitis C
    102282282 (STAT3)
   05171 Coronavirus disease - COVID-19
    102282282 (STAT3)
   05162 Measles
    102282282 (STAT3)
   05163 Human cytomegalovirus infection
    102282282 (STAT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102282282 (STAT3)
   05169 Epstein-Barr virus infection
    102282282 (STAT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102282282 (STAT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102282282 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bom03000]
    102282282 (STAT3)
Transcription factors [BR:bom03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    102282282 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 E2R135 DUF4795 Syntaxin-6_N AP1AR Fib_alpha
Other DBs
NCBI-GeneID: 102282282
NCBI-ProteinID: XP_005899266
LinkDB
Position
Un
AA seq 770 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTCLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEDAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN
TIDLPMSPRTLDSLMQFGNNGEAAQPSAGGQFESLTFDMELTSECATSPM
NT seq 2313 nt   +upstreamnt  +downstreamnt
atggcccaatggaatcagctccagcagctggacacacggtacttggagcagctccatcag
ctgtacagtgacagcttccccatggagctgcggcagtttctggccccttggattgagagt
caagattgggcatacgcggccagcaaagaatcacatgcgactttggtgtttcataatctc
ttgggagaaattgaccaacagtatagccgcttcctgcaagagtccaatgttctctatcag
cacaatttgcgaagaatcaagcagttccttcagagcagataccttgagaagccaatggag
attgcccgaattgtggcccgttgcctgtgggaagagtcccgcctcctccaaactgcagcc
actgcagcccagcaagggggccaggccaaccaccccacagccgccgtggtaacggagaag
cagcagatgctggagcagcacctgcaggacgtccgcaagcgtgtccaggatctagaacag
aagatgaaagtggtagagaatctccaggatgatttcgatttcaactataaaactctcaag
agtcaaggagacatgcaagatctgaatggaaacaaccagtcggtgaccaggcagaagatg
cagcagctcgaacagatgcttactgccctggaccagatgcggcgcagcatcgtgagtgag
ctggcggggcttttgtcagctatggagtatgtgcagaaaactctcacggatgaagaattg
gctgactggaagaggcgacaacagattgcttgcattggaggccctcccaacatctgccta
gatcggctagaaaactggataacctcattagcagaatctcagcttcagacccgccaacaa
attaagaaactggaggagctgcagcagaaggttagctacaaaggggaccccattgtacag
caccggccaatgctggaggagagaatcgtggagctgtttagaaacttaatgaaaagtgcc
ttcgtagtggagcggcagccctgcatgcctatgcatcctgaccggccattagtcatcaag
accggtgtccagttcacaactaaagtcagattgctggttaaattccctgagctaaattat
caacttaagattaaagtgtgcattgacaaagactccggggacgttgcagctctcagaggg
tcccggaaatttaacattctgggcacaaacacgaaagtgatgaacatggaagagtctaac
aatggcagcctctcagcggagttcaaacacttgaccctgagagagcagagatgcggtaat
gggggccgagccaattgtgatgcctccctgattgtgaccgaggagctgcacctgatcacc
tttgagactgaggtgtatcaccaaggcctcaagattgacctggagacccactccttgcca
gtggtggtgatctccaacatctgtcagatgcccaatgcctgggcgtccatcctatggtac
aacatgctgaccaacaaccccaagaacgtgaactttttcaccaaacccccgatcggaacg
tgggatcaagtggccgaggtgctgagctggcagttctcctctaccaccaagcgcgggctg
agcatcgagcagttgacgacgctggcggagaaactcttaggacctggtgtgaactattca
gggtgtcagatcacatgggctaaattttgcaaagaaaacatggctggcaagggcttctcc
ttctgggtctggctggacaacatcattgacctggtgaaaaagtacatcctggccctttgg
aacgaagggtatataatgggcttcatcagcaaggagagggaacgggccatcttgagcact
aagcccccaggtacctgcctgctgagattcagtgaaagcagcaaagaaggaggcgtcacc
ttcacctgggtggagaaggacatcagcggcaagacccagatccagtcagtggaaccttac
accaagcagcagctgaacaacatgtcatttgctgaaataatcatgggctataagatcatg
gatgccaccaatatcctggtgtctccactggtctatctctaccccgacattccaaaggag
gacgcgttcggaaagtactgtcggccggagagccaggagcatcctgaagctgacccaggt
agtgctgccccgtacctgaagaccaagttcatctgtgtgacaccaacgacctgcagcaat
accattgacctgccgatgtccccccgcactttagattcattgatgcagtttggaaataat
ggtgaagctgctcaaccctcagcaggagggcagtttgagtccctcacgttcgacatggag
ctgacctcggagtgcgctacctcccccatgtga

KEGG   Bos mutus (wild yak): 102282927
Entry
102282927         CDS       T02919                                 

Gene name
STAT5A
Definition
(RefSeq) signal transducer and activator of transcription 5A
  KO
K11223  signal transducer and activator of transcription 5A
Organism
bom  Bos mutus (wild yak)
Pathway
bom04012  ErbB signaling pathway
bom04217  Necroptosis
bom04630  JAK-STAT signaling pathway
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom04917  Prolactin signaling pathway
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom04935  Growth hormone synthesis, secretion and action
bom05161  Hepatitis B
bom05162  Measles
bom05166  Human T-cell leukemia virus 1 infection
bom05200  Pathways in cancer
bom05203  Viral carcinogenesis
bom05220  Chronic myeloid leukemia
bom05221  Acute myeloid leukemia
bom05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102282927 (STAT5A)
   04630 JAK-STAT signaling pathway
    102282927 (STAT5A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102282927 (STAT5A)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102282927 (STAT5A)
   04659 Th17 cell differentiation
    102282927 (STAT5A)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102282927 (STAT5A)
   04935 Growth hormone synthesis, secretion and action
    102282927 (STAT5A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102282927 (STAT5A)
   05203 Viral carcinogenesis
    102282927 (STAT5A)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102282927 (STAT5A)
   05220 Chronic myeloid leukemia
    102282927 (STAT5A)
   05223 Non-small cell lung cancer
    102282927 (STAT5A)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102282927 (STAT5A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102282927 (STAT5A)
   05161 Hepatitis B
    102282927 (STAT5A)
   05162 Measles
    102282927 (STAT5A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bom03000]
    102282927 (STAT5A)
Transcription factors [BR:bom03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    102282927 (STAT5A)
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 102282927
NCBI-ProteinID: XP_005899269
LinkDB
Position
Un
AA seq 802 aa
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGSSSAGILVDAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLNPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RQXXXXXXGKRHPTTLDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQ
IRRAEHLCQQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATV
RLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTL
SAHFRNMSLKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHG
SQDHNATATVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVF
LAQKLFNSSSSHLEDYNGMSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDG
AILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPDRNLWNLKPFTTRDFS
IRSLADRLGDLNYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVSASAD
SAGSNATYMDQAPSPAVCPQPHYNMYPQNPDPVLDQDGEFDLDETMDVARHVEELLRRPM
DSLEPSLPPPTGLFTPGRGSLS
NT seq 2409 nt   +upstreamnt  +downstreamnt
atggcgggctggatccaggcccagcagctgcagggagatgccctgcgccagatgcaggtg
ctatacgggcagcacttccccatcgaggtccggcattacttggcacagtggattgagagc
cagccgtgggatgccatcgacctggacaatccccaggaccgggcccaggccacccagctc
ctggagggcctggtgcaggagttgcagaagaaggcagagcaccaagtcggggaagacggg
ttccttctgaagatcaagctggggcactatgccacgcagctccagaacacgtacgaccgc
tgccccatggagctggtgcgctgcattcgccatattctgtacaatgaacagaggctggtc
cgagaagccaacaatggtagttcttctgctgggatcctggttgatgccatgtcccagaaa
caccttcagatcaaccagacatttgaggaactgcgactggtcacgcaggacacagagaat
gagctgaagaagctgcagcagactcaagagtatttcatcatccagtatcaggagagcctg
aggatccaggctcagtttgcccagctggcccagctgaacccccaggagcgactgagccgg
gagacggccctccagcagaagcaggtgtccctggaggcctggctgcagcgcgaggcccag
acgctgcagcagtaccgcgtggagctggccgagaagcaccagaagaccctgcagctgctg
cggcagnnnnnnnnnnnnnnnnnggggaagcgacaccccaccaccctggatgacgagctg
atccagtggaagcggcggcagcagctggcggggaacggagggccccccgagggcagcctg
gatgtgctacagtcctggtgtgagaagttggcggagatcatctggcagaaccggcagcag
atccgcagagccgagcacctctgccagcagctgcccatccccggccccgtggaggagatg
ctggctgaggtcaacgccaccatcactgacatcatctcagccctggtgaccagcaccttc
atcatcgagaagcagccccctcaggtcctgaagacccagaccaagttcgcggccaccgtg
cgcctgctggtgggcgggaagctgaatgtgcacatgaaccccccccaggtgaaggccacc
atcatcagcgagcagcaggccaagtcactgctcaagaacgagaacacccgcaatgagtgc
agcggggagatcctgaacaactgctgtgtgatggagtatcaccaggccacaggcaccctc
agcgcccacttcagaaacatgtccctcaagaggatcaagcgagctgaccggcgaggtgca
gagtctgtgacggaagagaagttcacggtcctgtttgagtctcaattcagtgttggcagc
aatgagcttgtgttccaggtgaagaccctgtcccttcccgtggttgtcatcgttcatggc
agccaggaccacaatgctactgccacggtgctgtgggacaatgcctttgctgagccgggc
agggtgccgtttgcagtgcccgacaaagtcctgtggccgcagctgtgcgaggcgctcaac
atgaaattcaaggccgaggtgcagagcaaccggggcctgaccaaggagaacctggtgttc
ctggcgcagaagctgttcaacagcagcagcagccatctcgaggactacaacggcatgtcc
gtgtcctggtcccagttcaaccgggagaacttgcccggctggaactacaccttttggcag
tggttcgacggggtcatggaggtgctgaagaaacatcacaagccccattggaatgacggg
gccatcctaggttttgtgaacaagcaacaggcccatgacctgctcatcaacaagcccgac
ggtaccttcttgttgcgcttcagcgactcagaaattgggggcatcaccatcgcctggaag
tttgactctcctgaccgtaacctgtggaatctgaagccattcaccacgcgggatttctcc
atccgatccctggccgacaggttgggggacctgaactatctcatctacgtgtttcccgac
cggcccaaggatgaggtcttctccaagtactacactcctgtgcttgctaaagcagtggac
ggatacgtgaagccacagatcaagcaagtggtccctgagtttgtgagcgcctctgcagac
tctgctggaagcaacgccacctacatggaccaggctccttccccagccgtgtgcccccag
cctcactataacatgtacccacagaaccctgacccggtgctcgaccaggatggagaattc
gacctggacgagaccatggatgtggcccggcacgtggaagaactcctccgccgcccaatg
gacagtctggagccctctctccccccgcccactggtctctttacccccggcagaggctcg
ctgtcctga

KEGG   Bos mutus (wild yak): 102283211
Entry
102283211         CDS       T02919                                 

Gene name
STAT5B
Definition
(RefSeq) signal transducer and activator of transcription 5B
  KO
K11224  signal transducer and activator of transcription 5B
Organism
bom  Bos mutus (wild yak)
Pathway
bom04012  ErbB signaling pathway
bom04062  Chemokine signaling pathway
bom04217  Necroptosis
bom04630  JAK-STAT signaling pathway
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom04917  Prolactin signaling pathway
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom04935  Growth hormone synthesis, secretion and action
bom05161  Hepatitis B
bom05162  Measles
bom05166  Human T-cell leukemia virus 1 infection
bom05200  Pathways in cancer
bom05203  Viral carcinogenesis
bom05220  Chronic myeloid leukemia
bom05221  Acute myeloid leukemia
bom05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102283211 (STAT5B)
   04630 JAK-STAT signaling pathway
    102283211 (STAT5B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102283211 (STAT5B)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102283211 (STAT5B)
   04659 Th17 cell differentiation
    102283211 (STAT5B)
   04062 Chemokine signaling pathway
    102283211 (STAT5B)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102283211 (STAT5B)
   04935 Growth hormone synthesis, secretion and action
    102283211 (STAT5B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102283211 (STAT5B)
   05203 Viral carcinogenesis
    102283211 (STAT5B)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102283211 (STAT5B)
   05220 Chronic myeloid leukemia
    102283211 (STAT5B)
   05223 Non-small cell lung cancer
    102283211 (STAT5B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102283211 (STAT5B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102283211 (STAT5B)
   05161 Hepatitis B
    102283211 (STAT5B)
   05162 Measles
    102283211 (STAT5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bom03000]
    102283211 (STAT5B)
Transcription factors [BR:bom03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    102283211 (STAT5B)
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 102283211
NCBI-ProteinID: XP_005899270
LinkDB
Position
Un
AA seq 793 aa
MAVWIQAQQLQGDALHQMQALYGQHFPIEVRHYLSQWIESQAWDSIDLDNPQENIKATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGTSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLNPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNS
SSSHLEDYNGMSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK
QQAHDLLINKPDGTFXXXXXXLLRFWDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIR
SLADRLGDLSYLIYVFPDRPKDEVYSKYYTPVPCEPATAKAVDGYVKPQIKQVVPEFVSA
SADSAGGSATYMDQAPSPAVCPQPHYNMYPQNPDPVLDNDGDFDLDDTIDVARRVEELLG
RPMDSQWIPHPQS
NT seq 2382 nt   +upstreamnt  +downstreamnt
atggctgtgtggatacaagcccagcagctccaaggagatgcccttcatcagatgcaagca
ctgtatggtcagcatttccccattgaggtgcgccattacttatcccagtggattgaaagc
caagcttgggactcaatagatcttgataatccacaggagaacattaaggccacccagctc
ctggagggcctggtgcaggagttgcagaagaaggcagagcaccaagtgggggaagacggg
ttcctactgaagatcaagctggggcactacgccacacagctccagaacacatatgaccgc
tgccccatggagctggtgcgctgcatccgccatattttgtacaatgaacagaggctggtc
cgagaagccaacaatggtacttctccggctggaagtctcgccgatgccatgtcccagaaa
caccttcaaatcaaccagacatttgaggagctgcgactggtcacacaagacacagagaat
gagctgaagaagctgcagcagactcaagagtatttcatcatccagtatcaggagagcctg
aggatccaggctcagtttgcccagctggcccagctgaacccccaggagcgactgagccgg
gagacagccctccagcagaagcaggtgtccctggaggcctggctgcagcgcgaggcccag
acgctgcagcagtaccgcgtggagctggccgagaagcaccagaagaccctgcagctgctg
cggaagcagcagaccatcatcctggatgacgagctgatccagtggaagcggcggcagcag
ctggcggggaacggagggccccccgagggcagcctggatgtgctacagtcctggtgtgag
aagttggcggagatcatctggcagaaccggcagcagatccgcagagccgagcacctctgc
cagcagctgcccatccccggccccgtggaggagatgctggctgaggtcaacgccaccatc
actgacatcatctcagccctggtgaccagcaccttcatcatcgagaagcagccccctcag
gtcctgaagacccagaccaagttcgcggccaccgtgcgcctgctggtgggcgggaagctg
aacgtgcacatgaaccccccccaggtgaaggccaccatcatcagcgagcagcaggccaag
tcactgctcaagaacgagaacacccgcaatgattacagcggggagatcctgaacaactgc
tgtgtaatggagtaccaccaggccacaggcaccctgagcgcccacttccggaacatgtcc
ctgaaacgaattaagagatctgaccggcgtggagcagagtcggtgacagaagaaaaattt
actatcctgtttgaatcacagttcagtgttggcggaaatgagctggtgtttcaagtcaag
accctgtctctcccagtggtggtgattgttcacggcagccaggataacaatgcgacggcc
accgttctctgggacaacgcttttgcagagcctggcagggtgccgtttgcagtgcccgac
aaagtcctgtggccgcagctgtgcgaggcgctcaacatgaaattcaaggccgaggtgcag
agcaaccggggcctgaccaaggagaacctggtgttcctggcgcagaagctgttcaacagc
agcagcagccacctcgaggactacaacggcatgtctgtgtcctggtcccagttcaaccgg
gagaatttacccggacggaattacactttctggcagtggtttgatggtgttatggaagtg
ttaaagaaacatctcaagcctcattggaatgacggggctatcttgggtttcgtgaacaag
caacaggcccacgacctgcttatcaacaagccagacgggaccttcnnnnnnnnnnnnnnn
nnnctgctgaggttctgggactctgaaatcggtggcatcaccattgcttggaagtttgat
tctcaggaaagaatgttttggaatctgatgccttttaccaccagagatttctccatccgg
tccctggccgaccgcttgggagacctgagttaccttatctacgtgtttcctgaccggccc
aaagacgaagtgtactccaagtattacaccccagttccatgcgagcctgccactgctaaa
gcagtggacgggtacgtgaagccacagatcaagcaggtggtccctgagtttgtgagcgcc
tctgcagactctgccggaggcagtgccacctacatggaccaggctccctccccagctgtg
tgcccccagcctcactataacatgtacccacagaaccccgaccccgtccttgacaacgat
ggtgacttcgatctggacgacacgattgacgtggcgcggcgtgtggaggagctcctaggc
cgacccatggacagtcagtggatcccccacccacagtcgtga

KEGG   Bos mutus (wild yak): 102283508
Entry
102283508         CDS       T02919                                 

Gene name
STAT1
Definition
(RefSeq) signal transducer and activator of transcription 1
  KO
K11220  signal transducer and activator of transcription 1
Organism
bom  Bos mutus (wild yak)
Pathway
bom04062  Chemokine signaling pathway
bom04217  Necroptosis
bom04380  Osteoclast differentiation
bom04620  Toll-like receptor signaling pathway
bom04621  NOD-like receptor signaling pathway
bom04625  C-type lectin receptor signaling pathway
bom04630  JAK-STAT signaling pathway
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom04917  Prolactin signaling pathway
bom04919  Thyroid hormone signaling pathway
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom04935  Growth hormone synthesis, secretion and action
bom05140  Leishmaniasis
bom05145  Toxoplasmosis
bom05152  Tuberculosis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
bom05212  Pancreatic cancer
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bom05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102283508 (STAT1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102283508 (STAT1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102283508 (STAT1)
   04621 NOD-like receptor signaling pathway
    102283508 (STAT1)
   04625 C-type lectin receptor signaling pathway
    102283508 (STAT1)
   04658 Th1 and Th2 cell differentiation
    102283508 (STAT1)
   04659 Th17 cell differentiation
    102283508 (STAT1)
   04062 Chemokine signaling pathway
    102283508 (STAT1)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102283508 (STAT1)
   04935 Growth hormone synthesis, secretion and action
    102283508 (STAT1)
   04919 Thyroid hormone signaling pathway
    102283508 (STAT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102283508 (STAT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102283508 (STAT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102283508 (STAT1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102283508 (STAT1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102283508 (STAT1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102283508 (STAT1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102283508 (STAT1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102283508 (STAT1)
   05160 Hepatitis C
    102283508 (STAT1)
   05171 Coronavirus disease - COVID-19
    102283508 (STAT1)
   05164 Influenza A
    102283508 (STAT1)
   05162 Measles
    102283508 (STAT1)
   05168 Herpes simplex virus 1 infection
    102283508 (STAT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102283508 (STAT1)
   05169 Epstein-Barr virus infection
    102283508 (STAT1)
   05165 Human papillomavirus infection
    102283508 (STAT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102283508 (STAT1)
   05140 Leishmaniasis
    102283508 (STAT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bom03000]
    102283508 (STAT1)
Transcription factors [BR:bom03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    102283508 (STAT1)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind STAT1_TAZ2bind SH2 TRPM_tetra NPV_P10
Other DBs
NCBI-GeneID: 102283508
NCBI-ProteinID: XP_005903038
LinkDB
Position
Un
AA seq 747 aa
MSQWYELQQLESKYLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIICNCLKEERKILDHAQ
RISQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMSIEHEIKTLEDLQDEYDFKCKTLQNR
EHETNGVAKNDQKQEQLLLQKMYLMLDNKRKEVVLKIIELLNATELTQKALINDELVEWK
RRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQA
LWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGARTN
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAE
PRNLSFFLNPPCARWSQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNAGPDGLIPWT
RFCKENINDKNFPFWLWIESILELIKKHLLALWNDGCIVGFISKERERALLKDQQPGTFL
LRFSESCREGAITFTWVERSQNGGEPYFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKFLYPNIDKDHAFGKYYSRPKEEPMELDGPKGTGYIKTELISVSEVHPSRLQTTDN
LLPMSPEEFDEVSRMVGSVEFDMMNAV
NT seq 2244 nt   +upstreamnt  +downstreamnt
atgtcccagtggtatgagcttcagcagcttgagtccaaatacctggagcaggttcaccag
ctctatgacgacagttttcccatggaaatcagacaatatctggcacagtggctagaaaag
caagactgggagcatgctgccaacgatgtttcatttgccaccatccgttttcatgacctg
ctatcgcagctggatgatcaatacagtcgcttttctttggagaataattttttattgcaa
cataacataaggaaaagcaagcgtaaccttcaggataattttcaggaagacccaatacag
atgtctatgatcatctgtaactgtctgaaggaggaaagaaagatcttggatcatgcccag
agaatcagccaggcgcagtctgggaatatccagagcactgtaatgttagacaaacagaag
gagcttgacagcaaagtcagaaatgtgaaagacaaagttatgagtattgagcatgaaatc
aagactctagaagacttgcaagatgaatatgactttaaatgcaaaaccttgcagaacaga
gaacatgaaaccaatggtgtggcaaagaatgatcagaaacaagaacagttgttactccag
aagatgtacttaatgctggacaataagagaaaggaagtcgttctcaaaataatagagttg
ttgaatgccactgaacttacccagaaagccctgattaatgatgaactggtggagtggaag
cggagacagcagagtgcctgtattggggggccccccaacgcttgcctggatcagctgcaa
aattggttcaccatagtggcggagagtctgcagcaggttcgtcagcagcttaaaaagctt
gaggagttggaacagaaatacacctatgaacatgaccccatcaccaaaaacaagcaagcc
ttatgggaccgcaccttcagcctcttccagcagctcattcagagctcatttgtggtggaa
agacagccctgcatgccaactcaccctcagaggccattggtcttgaagactggagtccag
ttcactgtgaagctgaggttgctggtgaagttgcaagagctgaattataacttgaaagtc
aaagtcttatttgacaaagatgtgaatgagagaaatacagtaaaagggtttaggaagttc
aacattctgggcactcacacgaaggtgatgaacatggaagagtccaccaacgggagtctg
gcggcagaattccgacacctgcaactgaaagaacaaaaaaatgccggtgccagaactaat
gagggtcctctcatcgtcactgaagagcttcactcccttagttttgaaacccagttgtgc
cagcctggtttggtcattgaccttgagacgacctctctacccgtcgtggtgatctccaat
gtcagccagctcccaagtggctgggcctctatcctgtggtacaacatgctggtggcagaa
ccccggaatctgtccttcttcctgaacccaccttgtgcacgatggtctcagctttcagag
gtgctgagttggcagttttcttctgtcaccaaaagaggtctcaatgtggaccagctgaac
atgctgggggagaagcttcttggccccaacgccggccccgatggtctgattccatggaca
aggttctgtaaggaaaatataaatgataaaaattttccgttctggctttggatcgaaagc
atccttgaactcattaaaaaacacctgcttgctctctggaatgatgggtgtatcgtgggc
tttattagcaaggagcgagagcgagccctgctgaaggaccaacagcctgggacgttcctg
ctgcgcttcagcgagagctgccgggaaggggcgatcacgttcacgtgggtggaacggtcc
caaaatggaggtgaaccttacttccacgcggttgaaccctacacaaagaaagaactttct
gcggttacttttcctgacattattcgtaattataaagtcatggctgctgaaaatattcca
gagaatcccctgaagtttctgtatccaaatattgataaagaccatgcctttggaaaatac
tactcccggccaaaggaagagcctatggaacttgatggccctaaaggaacaggatacatc
aagactgaattgatttctgtgtctgaagttcacccttctcgacttcagaccacagacaac
cttcttcccatgtctcctgaggagtttgacgaggtgtctcggatggtgggctctgtagaa
ttcgatatgatgaatgcggtctag

KEGG   Bos mutus (wild yak): 102283979
Entry
102283979         CDS       T02919                                 

Gene name
STAT4
Definition
(RefSeq) signal transducer and activator of transcription 4
  KO
K11222  signal transducer and activator of transcription 4
Organism
bom  Bos mutus (wild yak)
Pathway
bom04217  Necroptosis
bom04630  JAK-STAT signaling pathway
bom04658  Th1 and Th2 cell differentiation
bom05161  Hepatitis B
bom05200  Pathways in cancer
bom05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102283979 (STAT4)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102283979 (STAT4)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102283979 (STAT4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102283979 (STAT4)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102283979 (STAT4)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102283979 (STAT4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bom03000]
    102283979 (STAT4)
Transcription factors [BR:bom03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    102283979 (STAT4)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind SH2 Prp19 NPV_P10
Other DBs
NCBI-GeneID: 102283979
NCBI-ProteinID: XP_005903039
LinkDB
Position
Un
AA seq 751 aa
MSQWNQVQQLEIKFLEQVDQFYDDNFPMEIRHLLAQWIENQDWEAASNNETMATILLQNL
LIQLDEQLGRVSKEKNLLLIHNLKRIRKVLQGKFHGNPMHVAVVISNCLREERRILAAAN
MPVQGPLEKSLQSSSVSERQRNVEHKVAAIKNSVQMTEQDTKYLEDLQDEFDYRYKTIQT
MDQGDKNSALMNQEVLTLQEMLNSLDFKRKEALSKMTQIVNETDLLMNSMLVEELQDWKR
RQQIACIGGPLHSGLDQLQNCFTLLAESLFQLRRQLEKLEEQSSKMTYEGDPIPLQRAHL
LERVTFLIYNLFKNSFVVERQPCMPTHPQRPMVLKTLIQFTVKLRLLIKLPELNYQVKVK
ASIDKNASTLSNRRFVLCGTHVKAMSIEESSNGSLSVEFRHLQPKEMKSSAGNKGNEGCH
MVTEELHSITFETQICLYGLTIDLETCSLPVVMISNVSQLPNAWASIIWYNVSTNDSQNL
VFFNNPPSATLSQLLEVMSWQFSSYVGRGLNSDQLNMLAEKLTVQSSYNDGHLTWAKFCK
EHLPGKSFTFWTWLEAILDLIKKHILPLWIDGYIMGFVSKEKERLLLKDKMPGTFLLRFS
ESHLGGITFTWVDHSENGEVRFHSVEPYNKGRLSALPFADILRDYKVIMAENIPENPLKY
LYPDIPKDKAFGKHYSSQPCEVSRPTEKGDKGYVPSVFIPISTISSSRSDSTEPHSPSDL
LPMSPSVYAVLRENLSPTTIETAMKSPYSAE
NT seq 2256 nt   +upstreamnt  +downstreamnt
atgtctcagtggaatcaagtccaacagttagaaataaaatttttggagcaagttgatcaa
ttctatgatgacaactttcctatggaaattcggcatctgctggcccagtggattgaaaat
caggactgggaggcagcatctaacaatgaaactatggcaacaattcttcttcaaaacttg
ttaatacaactggatgaacagttaggccgtgtttccaaagagaaaaacctacttttaatt
cacaatctgaaaagaattaggaaagtccttcagggaaaatttcatggaaacccaatgcat
gtagctgtggttatttcaaattgtttaagggaagagaggagaatattggctgccgccaac
atgcctgttcagggacctctggagaaatccttacaaagttcttcagtttcagaaagacag
aggaatgtggagcacaaagtggctgccattaaaaatagcgtgcagatgacagaacaagac
accaaatatttagaagatctacaagatgaatttgattacaggtataaaacaattcagaca
atggatcagggtgacaagaacagtgccctaatgaatcaggaagttttaactctgcaggaa
atgctgaacagcctggacttcaaaagaaaggaagccctgagtaagatgacacaaatagtg
aatgagacggacttgttaatgaacagcatgctggtggaggagctgcaagactggaagagg
cgacagcaaatcgcctgcattggaggtccactccacagtgggctcgaccagcttcaaaac
tgctttacactgttggcagaaagtctgttccaactcagacggcagttggagaaattagag
gagcaatcttcgaaaatgacatacgaaggagatcctatcccattgcaaagagcacatctg
ctagaaagagtcaccttcttgatctacaacctttttaagaactcatttgtggttgaacga
cagccatgcatgccaacccaccctcagaggccgatggtacttaagactctcattcagttt
actgtaaagctaagactgctaataaaattaccagaactaaattatcaggtaaaggtgaaa
gcatcaattgacaagaatgcttcaactctaagcaatcgaagattcgtactttgtggaact
cacgtcaaagccatgtccattgaagaatcttccaacgggagtctctctgtagaatttcga
catttgcagccaaaggaaatgaagtctagtgctggaaacaaaggaaatgagggctgtcac
atggtgactgaggagcttcattccataacatttgagacacagatctgcctctatggactg
accatagatttggagacctgctcattacctgtggtgatgatttccaacgtcagtcaatta
cctaatgcttgggcgtccatcatttggtacaatgtgtcaaccaacgattcccagaacttg
gttttctttaataatcctccatctgccactttgagtcaactcctggaagtgatgagctgg
cagttttcatcatacgttggtcgtggcctgaactcagatcagctcaacatgctggccgag
aagctaacagtccagtctagctacaatgatggtcatctcacctgggccaagttctgcaag
gaacacttgcctggtaaatcatttaccttttggacctggcttgaagcaattttagaccta
attaagaaacacattcttcccctttggattgatgggtacatcatgggctttgttagcaaa
gaaaaggaacgactcttactaaaggataaaatgcctgggacctttttgttaagattcagt
gaaagccaccttggaggaataactttcacctgggtggaccattctgaaaacggagaagtg
agattccattctgtggaaccctacaacaaaggccggctgtccgctctgccgtttgctgac
atccttcgagactacaaggttattatggctgaaaacattcccgaaaaccctctgaagtac
ctctatcctgatattcccaaagacaaagccttcggtaaacactacagctcccagccatgc
gaagtttcaagaccaacagaaaagggagacaaaggttatgtcccttctgtttttatcccc
atctcaacaatctcttcaagccgaagtgattctacggagccacattctccatcagacctt
cttcccatgtcgccaagtgtatatgcagtgctgagagaaaacctgagtcccacaacaatc
gaaactgcaatgaagtctccctattctgctgaatga

KEGG   Bos mutus (wild yak): 102287830
Entry
102287830         CDS       T02919                                 

Gene name
STAT6
Definition
(RefSeq) signal transducer and activator of transcription 6
  KO
K11225  signal transducer and activator of transcription 6
Organism
bom  Bos mutus (wild yak)
Pathway
bom04217  Necroptosis
bom04630  JAK-STAT signaling pathway
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom05161  Hepatitis B
bom05200  Pathways in cancer
bom05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102287830 (STAT6)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102287830 (STAT6)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102287830 (STAT6)
   04659 Th17 cell differentiation
    102287830 (STAT6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102287830 (STAT6)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102287830 (STAT6)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102287830 (STAT6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bom03000]
    102287830 (STAT6)
Transcription factors [BR:bom03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    102287830 (STAT6)
SSDB
Motif
Pfam: STAT6_C STAT_bind STAT_int STAT_alpha SH2
Other DBs
NCBI-GeneID: 102287830
NCBI-ProteinID: XP_005901765
LinkDB
Position
Un
AA seq 847 aa
MSLWGLVSKMPPEKLQRLYVDFPQHLRHLLGDWLENQPWEFLVGSDTFCCNMASALLSAT
VQRLQASAGEQGEGNTILQHISTLETIYQRDPLKLVATCRHILQGEKKAVMEQFHHLPMS
FHWKQEELKFNTVLRRLQHRAGETRLLREALQPGAEAGQVSLHSLIETPTNGTGPSEALV
TLLQETVGELEAAQALVLKRIQIWKRQQQLAGNGAPFEESLAPLQERCESLVDIYSQLQQ
EVGAAGGELDPKTRAALISRLDEVLRTLVTSSFLVEKQPPQVLKTQTKXXXXXXFRLCLR
LVGPPPKPPLVRADMVTEKQARELSMPQGPGAGAESTGEIINNTVPLENSIPGNCCSALF
KNLLLKKIKRCERKGTESVTEEKCAVLFSTSLTLGPNKLPIQLQALSLPLVVIVHGNQDN
NAKATILWDNAFSEMDRVPFVVAERVPWEKMCETLNLKFMAEVGTNRGLLPEHFLFLAQK
IFNDNSLSMEAFQHRSVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIG
FISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIR
SLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPE
PQMPTMVPSYDLGMAPDSSMNLQLGPDMVPQVYPPRSHSIPSYPALPREESVNMLPAFQE
PHLPMPPNLSQMSLPFDQPHPQGLLPCPPQDHAVSSPEPLLCSDVTMAEDSCLNQPVGGF
PQGTWVREDMFPPLLPPTEQDLTKLLLEGQGESGGGSLGPQPLLQPSPYGQSGISMSHLD
LRANPSW
NT seq 2544 nt   +upstreamnt  +downstreamnt
atgtctctgtggggtctggtctccaaaatgcccccagaaaaactgcagcggctctatgtc
gactttcctcaacacctgcggcatctcctgggtgactggctggagaaccagccctgggaa
ttccttgtcggctcagacaccttctgctgcaacatggccagcgccctactttctgccact
gtccagcgccttcaggcctcagccggagagcagggggaggggaacaccatcttgcaacac
atcagcactctggagaccatttatcagagggaccccctgaagctggtggccacttgcaga
cacatacttcaaggtgaaaaaaaagctgttatggagcagttccaccacctgccaatgtcc
ttccactggaagcaggaggaactcaagtttaacacagtcctacggaggctgcagcaccgg
gccggggagacccgccttctccgggaggccctgcagcctggagctgaggctggccaagtg
tctttgcacagcttgatagaaacgcctaccaacgggactgggccaagtgaggccctggtc
acgctgctgcaggagactgttggtgagctggaagctgctcaggctctggtgctgaagagg
atccagatatggaagcggcaacagcagctggcagggaatggtgcaccctttgaggagagc
ctggctccactacaagagaggtgtgagagcctggtggacatttattcccagctgcagcag
gaggtgggggcagctggtggggagcttgatcccaagacccgggcagcgctgattagccga
ctggatgaagtcctgcgcacactcgtcaccagctctttcctggtggaaaagcagcccccc
caggttctgaagactcagaccaagnnnnnnnnnnnnnnnnnnttccggctgtgcctgagg
ctcgtggggcccccacccaagcctccgctggtcagggccgacatggtcacggagaagcag
gcgagggagctgagcatgccccaggggcccggagctggagcagaaagcaccggagaaatc
atcaacaacaccgtgcccctggagaacagcattcctgggaactgctgctctgcgctgttc
aagaacctgcttctgaagaaaatcaagcggtgtgagcggaagggcaccgagtctgtcacc
gaggagaagtgcgctgtgctcttctccaccagcctcacgcttggccctaacaaactcccc
atccagctccaggccctgtctctgcccctggtggtcatcgtccatggcaaccaagacaat
aatgccaaagccaccatcctgtgggacaatgccttctctgagatggaccgcgtgcccttt
gtggtggctgagcgggtgccctgggagaagatgtgtgaaactctgaacctcaagttcatg
gctgaagtggggaccaaccgggggttactcccagagcacttcctcttcctggcccagaag
atcttcaatgacaacagcctcagtatggaggccttccagcaccgttctgtgtcctggtca
cagttcaacaaggagatcctgctgggtcgtggcttcaccttttggcagtggtttgatggt
gtcctggatctcaccaaacgctgtctccggagctactggtcagaccggttgatcattggc
ttcatcagcaaacagtacgtcactagccttcttctcaacgagcctgatggaaccttcctc
cttcggttcagtgactcagagattgggggcatcaccattgcccacgtcatccgaggccag
gatggctccccacagatagagaatatccagccattctctgccaaagacctgtccattcgc
tcacttggggaccgaatccgggacctcgctcagctcaaaaacctctaccccaagaaaccc
aaggatgaggctttccggagccactacaaacctgagcagatgggtaaggatggcaggggt
tatgtcccagctacaatcaagatgactgtggaaagggaccagccacttcccaccccagag
ccccaaatgcctaccatggtgccctcttatgatcttggaatggcccctgattcctccatg
aacctgcagctcggcccagatatggtgccccaagtgtacccaccacgctctcactccatc
ccctcatatccagccctcccccgggaagaatcagtcaatatgttgccagccttccaggaa
cctcacctgccgatgcctcccaacctgagccagatgagcctgccctttgaccaacctcac
ccgcagggcctgctgccgtgcccacctcaggatcatgctgtgtccagccctgagcccttg
ctctgctcagacgtgaccatggcagaagacagctgcctgaaccagccggtgggagggttc
cctcaaggcacctgggtccgtgaagacatgttcccgcccttgttgcctcccactgaacag
gaccttaccaagcttctcttggagggacaaggggagtcagggggagggtccttgggaccc
caacccctcctgcagccctccccctatgggcagtctgggatctcaatgtcccacctggac
ctaagagctaaccccagttggtga

DBGET integrated database retrieval system