KEGG   Bos mutus (wild yak): 102277911
Entry
102277911         CDS       T02919                                 

Gene name
TNF
Definition
(RefSeq) tumor necrosis factor
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
bom  Bos mutus (wild yak)
Pathway
bom01523  Antifolate resistance
bom04010  MAPK signaling pathway
bom04060  Cytokine-cytokine receptor interaction
bom04061  Viral protein interaction with cytokine and cytokine receptor
bom04064  NF-kappa B signaling pathway
bom04071  Sphingolipid signaling pathway
bom04150  mTOR signaling pathway
bom04210  Apoptosis
bom04217  Necroptosis
bom04350  TGF-beta signaling pathway
bom04380  Osteoclast differentiation
bom04612  Antigen processing and presentation
bom04620  Toll-like receptor signaling pathway
bom04621  NOD-like receptor signaling pathway
bom04622  RIG-I-like receptor signaling pathway
bom04625  C-type lectin receptor signaling pathway
bom04640  Hematopoietic cell lineage
bom04650  Natural killer cell mediated cytotoxicity
bom04657  IL-17 signaling pathway
bom04660  T cell receptor signaling pathway
bom04664  Fc epsilon RI signaling pathway
bom04668  TNF signaling pathway
bom04920  Adipocytokine signaling pathway
bom04930  Type II diabetes mellitus
bom04931  Insulin resistance
bom04932  Non-alcoholic fatty liver disease
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom04940  Type I diabetes mellitus
bom05010  Alzheimer disease
bom05014  Amyotrophic lateral sclerosis
bom05020  Prion disease
bom05022  Pathways of neurodegeneration - multiple diseases
bom05132  Salmonella infection
bom05133  Pertussis
bom05134  Legionellosis
bom05135  Yersinia infection
bom05140  Leishmaniasis
bom05142  Chagas disease
bom05143  African trypanosomiasis
bom05144  Malaria
bom05145  Toxoplasmosis
bom05146  Amoebiasis
bom05152  Tuberculosis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05171  Coronavirus disease - COVID-19
bom05205  Proteoglycans in cancer
bom05310  Asthma
bom05321  Inflammatory bowel disease
bom05322  Systemic lupus erythematosus
bom05323  Rheumatoid arthritis
bom05330  Allograft rejection
bom05332  Graft-versus-host disease
bom05410  Hypertrophic cardiomyopathy
bom05414  Dilated cardiomyopathy
bom05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102277911 (TNF)
   04350 TGF-beta signaling pathway
    102277911 (TNF)
   04064 NF-kappa B signaling pathway
    102277911 (TNF)
   04668 TNF signaling pathway
    102277911 (TNF)
   04071 Sphingolipid signaling pathway
    102277911 (TNF)
   04150 mTOR signaling pathway
    102277911 (TNF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102277911 (TNF)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102277911 (TNF)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102277911 (TNF)
   04217 Necroptosis
    102277911 (TNF)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102277911 (TNF)
   04620 Toll-like receptor signaling pathway
    102277911 (TNF)
   04621 NOD-like receptor signaling pathway
    102277911 (TNF)
   04622 RIG-I-like receptor signaling pathway
    102277911 (TNF)
   04625 C-type lectin receptor signaling pathway
    102277911 (TNF)
   04650 Natural killer cell mediated cytotoxicity
    102277911 (TNF)
   04612 Antigen processing and presentation
    102277911 (TNF)
   04660 T cell receptor signaling pathway
    102277911 (TNF)
   04657 IL-17 signaling pathway
    102277911 (TNF)
   04664 Fc epsilon RI signaling pathway
    102277911 (TNF)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102277911 (TNF)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102277911 (TNF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102277911 (TNF)
  09163 Immune disease
   05310 Asthma
    102277911 (TNF)
   05322 Systemic lupus erythematosus
    102277911 (TNF)
   05323 Rheumatoid arthritis
    102277911 (TNF)
   05321 Inflammatory bowel disease
    102277911 (TNF)
   05330 Allograft rejection
    102277911 (TNF)
   05332 Graft-versus-host disease
    102277911 (TNF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102277911 (TNF)
   05014 Amyotrophic lateral sclerosis
    102277911 (TNF)
   05020 Prion disease
    102277911 (TNF)
   05022 Pathways of neurodegeneration - multiple diseases
    102277911 (TNF)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102277911 (TNF)
   05410 Hypertrophic cardiomyopathy
    102277911 (TNF)
   05414 Dilated cardiomyopathy
    102277911 (TNF)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102277911 (TNF)
   04940 Type I diabetes mellitus
    102277911 (TNF)
   04932 Non-alcoholic fatty liver disease
    102277911 (TNF)
   04931 Insulin resistance
    102277911 (TNF)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102277911 (TNF)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102277911 (TNF)
   05135 Yersinia infection
    102277911 (TNF)
   05133 Pertussis
    102277911 (TNF)
   05134 Legionellosis
    102277911 (TNF)
   05152 Tuberculosis
    102277911 (TNF)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102277911 (TNF)
   05170 Human immunodeficiency virus 1 infection
    102277911 (TNF)
   05161 Hepatitis B
    102277911 (TNF)
   05160 Hepatitis C
    102277911 (TNF)
   05171 Coronavirus disease - COVID-19
    102277911 (TNF)
   05164 Influenza A
    102277911 (TNF)
   05168 Herpes simplex virus 1 infection
    102277911 (TNF)
   05163 Human cytomegalovirus infection
    102277911 (TNF)
   05169 Epstein-Barr virus infection
    102277911 (TNF)
   05165 Human papillomavirus infection
    102277911 (TNF)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102277911 (TNF)
   05144 Malaria
    102277911 (TNF)
   05145 Toxoplasmosis
    102277911 (TNF)
   05140 Leishmaniasis
    102277911 (TNF)
   05142 Chagas disease
    102277911 (TNF)
   05143 African trypanosomiasis
    102277911 (TNF)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    102277911 (TNF)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Tumor necrosis fators
   102277911 (TNF)
Glycosaminoglycan binding proteins [BR:bom00536]
 Heparan sulfate / Heparin
  Cytokines
   102277911 (TNF)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 102277911
NCBI-ProteinID: XP_005904240
UniProt: L8I119
LinkDB
Position
Un
AA seq 234 aa
MSTKSMIRDVELAEEVLSEKAGGPQGSRSCLCLSLFSFLLVAGATTLFCLLHFGVIGPQR
EEQSPGGPSINSPLVQTLRSSSQASSNKPVAHVVADINSPGQLRWWDSYANALMANGVKL
EDNQLVVPADGLYLIYSQVLFRGQGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHR
ETPEWAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPDYLDYAESGQVYFGIIAL
NT seq 705 nt   +upstreamnt  +downstreamnt
atgagcaccaaaagcatgatccgggatgtggagctggcggaggaggtgctctccgagaaa
gcagggggcccccagggctccagaagttgcttgtgcctcagcctcttctccttcctcctg
gttgcaggagccaccacgctcttctgcctgctgcacttcggggtaatcggcccccagagg
gaagagcagtccccaggtggcccctccatcaacagccctctggttcagacactcaggtcc
tcttctcaagcctcaagtaacaagccggtagcccacgttgtagccgacatcaactctccg
gggcagctccggtggtgggattcgtatgccaatgccctcatggccaacggtgtgaagctg
gaagacaaccagctggtggtgcctgctgacgggctttacctcatctactcacaggtcctc
ttcaggggccaaggctgcccttccacccccttgttcctcacccacaccatcagccgcatt
gcagtctcctaccagaccaaggtcaacatcctgtctgccatcaagagcccttgccacagg
gagaccccagagtgggctgaggccaagccctggtacgaacccatctaccagggaggagtc
ttccagctggagaagggagatcgcctcagtgctgagatcaacctgccggactacctggac
tatgccgagtctgggcaggtctactttgggatcatcgccctgtga

DBGET integrated database retrieval system