KEGG   Bos mutus (wild yak): 102277938
Entry
102277938         CDS       T02919                                 

Gene name
LPAR4
Definition
(RefSeq) lysophosphatidic acid receptor 4
  KO
K04275  lysophosphatidic acid receptor 4
Organism
bom  Bos mutus (wild yak)
Pathway
bom04015  Rap1 signaling pathway
bom04072  Phospholipase D signaling pathway
bom04080  Neuroactive ligand-receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04810  Regulation of actin cytoskeleton
bom05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102277938 (LPAR4)
   04072 Phospholipase D signaling pathway
    102277938 (LPAR4)
   04151 PI3K-Akt signaling pathway
    102277938 (LPAR4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102277938 (LPAR4)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102277938 (LPAR4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102277938 (LPAR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bom04030]
    102277938 (LPAR4)
G protein-coupled receptors [BR:bom04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    102277938 (LPAR4)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx Serpentine_r_xa 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 102277938
NCBI-ProteinID: XP_005889519
UniProt: L8J0G1
LinkDB
Position
Un
AA seq 370 aa
MGDRRFIDFQFQDLNSNLRPRLGNATANNTCIVDDSFKYNLNGAVYSVVFILGLITNSAS
LFVFCFRMKMRSETAIFITNLALSDLLFVCTLPFKIFYNFNRHWPFGDTLCKISGTAFLT
NIYGSMLFLTCISVDRFLAIVYPFRSRTIRTRRNSAIVCAGVWILVLSGGISASLFSTTN
VNNATTTCFEGFSKRVWKTYLSKITIFIEVVGFIIPLILNVSCSSVVLKTLRKPATLSQI
GTNKKKVLKMITVHMAVFVVCFVPYNSVLFLYALVRSQAITNCLLERFAKIMYPITLCLA
TLNCCFDPFIYYFTLESFQKSFYINTHIKMESLFKTETPLTTKPSLPAIQEEASDQTTHN
GGELMLESTF
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgggtgacagaagattcattgacttccaattccaagatttaaattcaaacctcagaccc
aggttgggcaatgctactgccaataatacttgcattgttgatgattccttcaagtataat
ctgaatggtgctgtctacagtgttgtattcatcctgggtttgataaccaacagtgcatct
ctgttcgtcttctgcttccgcatgaaaatgagaagtgagacagctattttcatcaccaat
ctggccctctctgatttgctctttgtctgcactctacctttcaaaatattttacaatttc
aaccgccactggccttttggtgataccctctgcaagatctctgggactgcattcctaacc
aacatctatgggagcatgctcttccttacctgtattagcgtggatcgtttcctggccatt
gtctatcccttccgatcccgtaccattaggaccaggaggaattctgccattgtatgtgct
ggagtctggatcctagtcctcagtggtggtatttcagcctctttattctccaccactaat
gtcaacaatgcaaccaccacctgctttgagggcttctccaaacgtgtatggaagacatat
ctgtccaagataaccatatttattgaagttgttggttttatcattcctttgatactgaat
gtctcttgctcttctgtggtgctaaaaaccctccgtaagcctgctacattgtctcaaatt
gggactaataagaaaaaagtgctgaagatgatcacagtgcatatggcagtctttgtggta
tgctttgtaccctataactctgttctcttcctgtatgccctggtgcgctcccaagccatt
accaattgcttgttggaaagatttgcaaagattatgtatccaatcaccttgtgccttgca
actctaaactgttgctttgaccctttcatctattacttcacccttgagtcctttcagaag
tccttctatatcaatacccatatcaagatggagtctctgtttaagactgaaacacctctg
accacaaagccttcccttccagctattcaagaggaagctagcgatcaaacaacacataat
ggtggtgaattaatgctagaatccaccttctag

DBGET integrated database retrieval system