KEGG   Bos mutus (wild yak): 102278631Help
Entry
102278631         CDS       T02919                                 

Gene name
BRAF
Definition
(RefSeq) B-Raf proto-oncogene, serine/threonine kinase
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bom  Bos mutus (wild yak)
Pathway
bom01521  EGFR tyrosine kinase inhibitor resistance
bom01522  Endocrine resistance
bom04010  MAPK signaling pathway
bom04012  ErbB signaling pathway
bom04015  Rap1 signaling pathway
bom04024  cAMP signaling pathway
bom04062  Chemokine signaling pathway
bom04068  FoxO signaling pathway
bom04150  mTOR signaling pathway
bom04270  Vascular smooth muscle contraction
bom04510  Focal adhesion
bom04650  Natural killer cell mediated cytotoxicity
bom04720  Long-term potentiation
bom04722  Neurotrophin signaling pathway
bom04726  Serotonergic synapse
bom04730  Long-term depression
bom04810  Regulation of actin cytoskeleton
bom04910  Insulin signaling pathway
bom04914  Progesterone-mediated oocyte maturation
bom04928  Parathyroid hormone synthesis, secretion and action
bom04934  Cushing syndrome
bom05034  Alcoholism
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05200  Pathways in cancer
bom05205  Proteoglycans in cancer
bom05210  Colorectal cancer
bom05211  Renal cell carcinoma
bom05212  Pancreatic cancer
bom05213  Endometrial cancer
bom05214  Glioma
bom05215  Prostate cancer
bom05216  Thyroid cancer
bom05218  Melanoma
bom05219  Bladder cancer
bom05220  Chronic myeloid leukemia
bom05221  Acute myeloid leukemia
bom05223  Non-small cell lung cancer
bom05224  Breast cancer
bom05225  Hepatocellular carcinoma
bom05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102278631 (BRAF)
   04010 MAPK signaling pathway
    102278631 (BRAF)
   04012 ErbB signaling pathway
    102278631 (BRAF)
   04068 FoxO signaling pathway
    102278631 (BRAF)
   04024 cAMP signaling pathway
    102278631 (BRAF)
   04150 mTOR signaling pathway
    102278631 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102278631 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102278631 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102278631 (BRAF)
   04062 Chemokine signaling pathway
    102278631 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102278631 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    102278631 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    102278631 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102278631 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    102278631 (BRAF)
   04720 Long-term potentiation
    102278631 (BRAF)
   04730 Long-term depression
    102278631 (BRAF)
   04722 Neurotrophin signaling pathway
    102278631 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102278631 (BRAF)
   05205 Proteoglycans in cancer
    102278631 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102278631 (BRAF)
   05212 Pancreatic cancer
    102278631 (BRAF)
   05225 Hepatocellular carcinoma
    102278631 (BRAF)
   05226 Gastric cancer
    102278631 (BRAF)
   05214 Glioma
    102278631 (BRAF)
   05216 Thyroid cancer
    102278631 (BRAF)
   05221 Acute myeloid leukemia
    102278631 (BRAF)
   05220 Chronic myeloid leukemia
    102278631 (BRAF)
   05218 Melanoma
    102278631 (BRAF)
   05211 Renal cell carcinoma
    102278631 (BRAF)
   05219 Bladder cancer
    102278631 (BRAF)
   05215 Prostate cancer
    102278631 (BRAF)
   05213 Endometrial cancer
    102278631 (BRAF)
   05224 Breast cancer
    102278631 (BRAF)
   05223 Non-small cell lung cancer
    102278631 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    102278631 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102278631 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102278631 (BRAF)
   05160 Hepatitis C
    102278631 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102278631 (BRAF)
   01522 Endocrine resistance
    102278631 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bom01001]
    102278631 (BRAF)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102278631 (BRAF)
Protein kinases [BR:bom01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   102278631 (BRAF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2 APH Kdo
Motif
Other DBs
NCBI-GeneID: 102278631
NCBI-ProteinID: XP_005901136
LinkDB All DBs
Position
Un
AA seq 857 aa AA seqDB search
MPQLLFVTVFSHKSLILGCGTQKCSPCKQKVLWDRRFTVEENYDWGVVSELVAEAMVWNI
KQMIKLTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFS
VSSSASTDTVTSSSSSSLSVLPSSLSVFQNPTDVSRSNPKSPQKPIVRVFLPNKQRTVVP
ARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENV
PLTTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLF
VSKFFEHHPIPQEEASLAETTLPCGSSPSAPPSDSIGPPILTSPSPSKSIPIPQPFRPAD
EDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRSDGAPLNQLMRCLRKYQSRTP
SPLLHSVPSEIVFDFEPGPVFRGSTTGLSATPPASLPGSLSNVKALQKSPGPQRERKSSS
SSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAP
TPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEM
IKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQF
EQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVG
RGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLLSVNWFGLLKGLGRLHKLKVHTPF
ALVFPLREIYSICYRICFQILASIELLARSLPKIHRSASEPSLNRAGFQTEDFSLYACAS
PKTPIQAGGYGEFAAFK
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atgccccagttattatttgtgacagtattttcccacaaatctttgattttaggatgtggc
acacagaagtgttccccatgtaaacagaaagtgctttgggataggagatttacagtggaa
gaaaattatgactggggagttgtatcagaattagtagcagaagccatggtgtggaatatc
aaacaaatgattaagttgacacaggagcatatagaggccctattggacaaatttggtggg
gagcataatccaccatcaatatatctggaggcctatgaagaatacaccagcaagctagat
gccctccaacaaagagaacaacagttattggaatccctggggaatggaactgatttttct
gtttctagctctgcatcaacggacaccgttacatcttcttcctcttctagcctttcagtg
ctgccttcatctctttcagtttttcaaaatcccacagatgtgtcacggagcaaccccaag
tcaccacaaaaacctatcgttagagtcttcctgcccaataaacagaggacagtggtacct
gcacggtgtggagtcacagtccgggacagcctgaagaaggcactgatgatgagaggtcta
atcccagagtgctgtgctgtttacagaattcaggatggggagaagaaaccaattggctgg
gacactgatatttcctggcttactggagaggagttgcatgtagaagtgttggagaatgtt
ccacttacaacacacaactttgtacggaaaacttttttcaccttagcattttgtgacttc
tgtagaaagctgcttttccaggggttccgctgtcaaacatgtggttataaatttcaccag
cgttgtagtacagaggttccactgatgtgtgttaattatgaccaactagatttgctgttt
gtctccaagttctttgaacaccacccaataccacaggaggaggcctccttagcagagact
acccttccatgtggctcatccccttctgcacccccctccgattctattgggcccccaatt
ctcaccagtccatctccttcaaaatccattccaattccacagcctttccgaccagcagat
gaagatcatcgaaatcagtttggacaacgagaccggtcctcatcagctccaaatgtgcat
ataaacacaatagaacccgtcaatattgatgacttgattagagaccaagggtttcgtagt
gatggagcccctttgaaccagctgatgcgctgtcttcggaaataccaatcccggactccc
agtcccctcctacattctgtccccagtgaaatagtgtttgattttgagcctggcccagtg
ttcagaggatcaaccacaggtttatccgccacaccccctgcctcattacctggctcactc
tctaatgtgaaagcattgcagaaatctccaggacctcagcgagaaagaaagtcctcttca
tcctcagaagacaggaatcgaatgaaaacgcttggtagacgggattcaagtgacgattgg
gagattcctgatggacagatcacagtgggacaaagaattggatcagggtcatttgggaca
gtctacaagggaaagtggcatggtgatgtggcagtgaaaatgttgaatgtgacagcaccc
acacctcagcagttacaggccttcaaaaatgaagtaggagtactcaggaaaacacgacat
gtgaatatcctcctcttcatgggttattcaacaaagccacaactggctattgttacccag
tggtgtgagggctccagtttatatcatcatctccacatcattgagaccaaattcgagatg
atcaaacttatagatattgcacggcagactgcacagggcatggattacttacacgccaag
tcaatcatccacagagacctcaagagtaataatatttttcttcatgaagacctcacagta
aaaataggtgattttggtctagccacagtgaaatctcgatggagtgggtcccatcagttt
gaacagttgtctggatccattttgtggatggcaccagaagtaatcagaatgcaagataaa
aacccatatagctttcagtcagatgtatatgcatttgggattgttctgtatgaattgatg
accggacagttaccttattcaaatatcaacaacagggaccagataatttttatggtggga
cgaggatatctgtctccagatctcagtaaggtacggagtaactgtccaaaagccatgaag
agattaatggcagagtgcctaaaaaagaaaagagatgaaagaccactcttgagtgtaaat
tggtttggccttttgaaaggacttggtagactccataaacttaaagtacatacacctttt
gctctggtttttccactccgagaaatctactctatatgctacagaatctgcttccaaatt
ctcgcctctattgagctgctggcccgctcattgccaaaaattcaccgcagtgcatcagaa
ccctccttgaatcgggctggcttccaaacagaggattttagtctatatgcttgtgcttct
ccaaaaacacccattcaggcagggggatatggagaatttgcagccttcaagtag

DBGET integrated database retrieval system