KEGG   Bos mutus (wild yak): 102278692
Entry
102278692         CDS       T02919                                 

Gene name
JAK2
Definition
(RefSeq) Janus kinase 2
  KO
K04447  Janus kinase 2 [EC:2.7.10.2]
Organism
bom  Bos mutus (wild yak)
Pathway
bom01521  EGFR tyrosine kinase inhibitor resistance
bom04062  Chemokine signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04217  Necroptosis
bom04550  Signaling pathways regulating pluripotency of stem cells
bom04630  JAK-STAT signaling pathway
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom04725  Cholinergic synapse
bom04917  Prolactin signaling pathway
bom04920  Adipocytokine signaling pathway
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom04935  Growth hormone synthesis, secretion and action
bom05140  Leishmaniasis
bom05145  Toxoplasmosis
bom05152  Tuberculosis
bom05161  Hepatitis B
bom05164  Influenza A
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05200  Pathways in cancer
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102278692 (JAK2)
   04151 PI3K-Akt signaling pathway
    102278692 (JAK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102278692 (JAK2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102278692 (JAK2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102278692 (JAK2)
   04659 Th17 cell differentiation
    102278692 (JAK2)
   04062 Chemokine signaling pathway
    102278692 (JAK2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102278692 (JAK2)
   04917 Prolactin signaling pathway
    102278692 (JAK2)
   04935 Growth hormone synthesis, secretion and action
    102278692 (JAK2)
  09156 Nervous system
   04725 Cholinergic synapse
    102278692 (JAK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102278692 (JAK2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102278692 (JAK2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102278692 (JAK2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102278692 (JAK2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102278692 (JAK2)
   05164 Influenza A
    102278692 (JAK2)
   05168 Herpes simplex virus 1 infection
    102278692 (JAK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102278692 (JAK2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102278692 (JAK2)
   05140 Leishmaniasis
    102278692 (JAK2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102278692 (JAK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bom01001]
    102278692 (JAK2)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102278692 (JAK2)
Protein kinases [BR:bom01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   102278692 (JAK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl SH2 RIO1 Kinase-like APH
Other DBs
NCBI-GeneID: 102278692
NCBI-ProteinID: XP_005891424
UniProt: L8IT24
LinkDB
Position
Un
AA seq 1132 aa
MGMACLTMTEMEGTSTSPVHQNGDISGNANSVKQIDPVLQVYLYHSLGNAEGDYLQFLTG
EYVAEEICIAASKACGITPVYHSMFALMSETERIWYPPNHVFHIDESTRQNVLYRIRFYF
PYWYCNGSNRTYRHGIARGAEAPLLDDFVMSYLFAQWRHDFLHGWIKVPVTHETQEECLG
MAVLDMMRIAKEKNQTPLDIYSSISYKTFLPKCVRAKIQEYHILTRKRIRYRFRRFIEQF
SHCKATARNLKLKYLINLETLQSAFYTEQFEVKEPGRGPSGEEIFATIIITGNGGIQWSR
GKHKESETLTEQDLQLYCDFPDIIDISIKQANQEGANESRIVTIHKQDGKSLEIELKSLR
EALSFVSLIDGYYRLTADAHHYLCKEVAPPMVLENIQSNCHGPISMDFAISKLKKTGNQT
GLYVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENGEYNLSGTKKNFSNLKDLLNC
YQMETVRSDSIIFQFTKCCPPKPKDKSNLLVFRTNGISDVPTSPTLQRHNNVNQMVFHKI
RNEDLVFNESLGQGTFTKIFKGIRREIGDYGQLHETEVLLKVLDKAHRNYSESFFEAASM
MSQLSHKHLILNYGVCVCGEENILVQEFVKFGSLDTYLKKNKNSINILWKLEVAKQLAWA
MHFLEEKTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVP
PECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWTEL
ANLINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRD
PTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIE
ILKSLQHDNIVKYKGVCYSAGRHNLRLIMEYLPYGSLRDYLQKHKERIDHKKLLQYTSQI
CKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFW
YAPESLTESKFSVASDVWSFGVVLYELFTYIDKSKSPPAEFMRMIGNDKQGQMIVFHLIE
LLKNNGRLPRPDGCPDEIYVIMTECWNNNVNQRPSFRDLAVRVDQIRDNMTG
NT seq 3399 nt   +upstreamnt  +downstreamnt
atgggaatggcttgccttacaatgacagaaatggaaggaacatccacatcccctgtacat
cagaatggtgatatttctggaaatgctaactctgtgaagcaaatagatccagtcctacag
gtctatctttatcattcccttgggaacgctgagggggattatctgcagtttctaactgga
gagtatgttgctgaagagatctgtattgctgcttctaaagcttgtggaatcacacctgta
tatcacagtatgtttgctttaatgagtgaaacagaaaggatctggtatccacccaaccat
gtcttccatatagatgaatcaaccaggcaaaacgtactctacagaatcagattttacttc
ccttactggtattgtaatggcagcaacagaacctatcgacatggaatagctcgaggtgct
gaagctcctcttcttgatgactttgtcatgtcttacctttttgctcagtggcggcatgat
tttttacatggatggataaaagtacctgtgactcatgaaacacaggaagaatgtcttggg
atggcagtgttagatatgatgagaatagccaaagaaaagaatcaaaccccactggacatc
tatagctctatcagctacaagacatttttgccaaaatgtgttcgagcaaagatccaagag
tatcatattttgacaaggaagagaataaggtacagatttcgcagatttattgagcaattc
agccattgcaaagccactgccagaaacttgaaacttaagtatcttataaatctggaaact
cttcagtctgccttctacacagagcaatttgaagtaaaagaacctggaagaggtccttca
ggtgaggagatttttgcaaccattataataactggaaacggtggaattcagtggtcaaga
gggaaacataaagaaagtgagacactgacagaacaggatttacagttgtattgtgatttt
cctgatattattgatatcagtattaaacaagcaaatcaagaaggcgcaaatgaaagcaga
attgtaactattcataagcaagatggtaaaagtctagaaattgagcttaagtcattaaga
gaagctttgtcttttgtgtcattaattgatggatattatagattaactgcagatgcacat
cattatctttgtaaagaagtagcacctccaatggtgcttgaaaatatacaaagcaactgt
catggcccaatttcaatggattttgctatcagtaaactgaagaaaacaggtaatcagact
ggactctatgtacttcgatgcagtcctaaggactttaataaatattttctgacttttgct
gttgagcgagaaaatgttattgaatataagcactgtttgattaccaaaaatgagaatgga
gaatacaacctcagtggtactaagaagaacttcagtaatcttaaagatcttctgaattgc
taccagatggaaactgttcgctcagacagtataattttccagtttactaaatgctgtccc
ccaaagccaaaagacaaatcaaaccttctagtcttcagaaccaatggtatttctgatgta
ccaacctcaccaactttacaaaggcataataatgtgaaccaaatggtgttccacaaaatt
agaaatgaagatttggtatttaatgaaagccttggccaaggaacttttacaaaaattttt
aaaggtataagaagagaaataggagactatggtcagcttcatgaaacagaagttctttta
aaagttctggataaagcacatagaaactattcagagtctttctttgaagcagcaagcatg
atgagccagctttctcacaaacatctgattttaaattatggagtatgtgtctgtggagag
gagaatattctggttcaggaatttgtaaaatttggatcactagatacgtatctgaaaaag
aataaaaattctataaatatattatggaaacttgaagtggctaaacagttggcatgggcc
atgcattttctagaagaaaaaacccttattcatgggaatgtgtgcgccaaaaatattctt
cttatcagagaagaagacaggaagacaggaaatcctcctttcatcaaacttagtgatcct
ggcattagtattacagttttgccaaaagacatcctgcaggagagaataccatgggtacca
cctgaatgcattgaaaatcctaaaaatctaaacctggcaacagacaaatggagttttggt
accacattgtgggaaatctgcagtggaggagataagcctctgagtgctttggattctcaa
agaaaactacagttttatgaagataggcaccagcttcctgcgccaaagtggacagaatta
gcaaatcttattaataattgcatggattatgaaccagattttaggccttctttcagagcc
attataagagatcttaatagtttgtttactccagattatgaactattaacagaaaatgac
atgttaccaaatatgagaataggtgctctaggattttctggtgcttttgaagaccgagac
cctacacaatttgaagaaagacacttgaaatttctacagcaacttggcaagggtaatttt
gggagtgtggagatgtgtcggtatgaccctctacaagacaatactggggaggtggtggct
gtgaaaaagctccagcacagtactgaagagcacctcagagacttcgaaagagaaattgaa
atccttaaatccttgcagcatgacaacattgtaaagtacaaaggagtctgctacagtgct
ggccggcataatctaagattaattatggagtatttaccatatggaagtttacgagactat
ctccaaaaacataaagaacggatagatcataaaaaacttctgcaatacacatctcagata
tgcaaggggatggaatatcttggtacaaaaagatatatccacagggatctggcaacaagg
aatatattagtggagaatgaaaacagagttaaaataggagattttggattaaccaaagtc
ttgccacaagacaaagagtactacaaagtgaaagagcctggtgaaagtcccatattctgg
tatgcaccagaatcactgacagagagcaagttttctgtggcttcagatgtttggagcttt
ggagtggttctgtatgaacttttcacatatattgacaagagtaaaagcccaccagcggaa
tttatgcgtatgattggcaatgacaaacaaggacagatgattgtgttccatttgatagaa
ctcctgaagaataacggaagattaccaagaccagatggatgcccagatgagatatatgtg
attatgacagaatgctggaacaataatgtaaaccagcgcccctctttcagagacctagca
gttcgagttgatcaaataagggacaacatgactggatga

KEGG   Bos mutus (wild yak): 102286011
Entry
102286011         CDS       T02919                                 

Gene name
JAK3
Definition
(RefSeq) Janus kinase 3
  KO
K11218  Janus kinase 3 [EC:2.7.10.2]
Organism
bom  Bos mutus (wild yak)
Pathway
bom04062  Chemokine signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04217  Necroptosis
bom04550  Signaling pathways regulating pluripotency of stem cells
bom04630  JAK-STAT signaling pathway
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom05161  Hepatitis B
bom05162  Measles
bom05166  Human T-cell leukemia virus 1 infection
bom05169  Epstein-Barr virus infection
bom05200  Pathways in cancer
bom05203  Viral carcinogenesis
bom05223  Non-small cell lung cancer
bom05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102286011 (JAK3)
   04151 PI3K-Akt signaling pathway
    102286011 (JAK3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102286011 (JAK3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102286011 (JAK3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102286011 (JAK3)
   04659 Th17 cell differentiation
    102286011 (JAK3)
   04062 Chemokine signaling pathway
    102286011 (JAK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102286011 (JAK3)
   05203 Viral carcinogenesis
    102286011 (JAK3)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    102286011 (JAK3)
  09163 Immune disease
   05340 Primary immunodeficiency
    102286011 (JAK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102286011 (JAK3)
   05161 Hepatitis B
    102286011 (JAK3)
   05162 Measles
    102286011 (JAK3)
   05169 Epstein-Barr virus infection
    102286011 (JAK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bom01001]
    102286011 (JAK3)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102286011 (JAK3)
Protein kinases [BR:bom01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   102286011 (JAK3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl Kdo APH
Other DBs
NCBI-GeneID: 102286011
NCBI-ProteinID: XP_014334338
LinkDB
Position
Un
AA seq 1104 aa
MAPPSEETPLISQRSCSLSSSEAGALHVLLPPRGPGPPQCLSFSFGDHSAEDLCVCAAKA
SGILPVYHSLFALALEDLSCWFPPSHIFSVEDTGTQVLVYRLRFYFPNWFGLEKCHRFGL
RKDLTSAILDLPVLEHLFAQHRHDLVSGRLRVGLSLKEQGECLSLAVLDLARMALEQAQR
PEELLKTVSYKVCLPPGLRDLIQGLSFVTRRRIRRTVCRALRGVATCQADRHSLMVKYIM
DLERLDPDRAAETFRVGLPGAAGGQDTPGLLRVAGGSGIAWSPGEHEVLQPFCDFPEIVD
ISIKQAPCIGPAAEHRLVTITRTDNQILEAEFPGLPAALSFVALVDGYFRLTTDSRHYFC
KEVAPPRLLEEVAEQCHGPITLDFAINKLKTGGSLPGSYVLRRSPQDFDSYLLTVCVLTP
LGPDYKGCLIRCDPTGTFSLAGLGRSHSSLRELLAACWNGGLHVDGVELYLTFCCNPRPK
EKSNLIVVRRGCNPPTSSPVQPQFQCQLSQMTFHKIPADSLQWHENLGHGSFTKIYRGCH
HEIVDGEARETEVLLKVMDAKHKNCMESFLEAASLMSQVSYQHLVLLHGVCMAGDSIMVQ
EFVRLGALDTYLRKCGHLVPASWKLQVIKQLAYALNYLEDKGLPHGNVSARKVLLAREGT
DGNLPFIKLSDPGVSPTVLSLEMLTDRIPWVAPECLQEARTLGLEADKWGFGATVWEVFS
GVTVPISTLEPAKKLQFYQERQQLPAPKWMELALLIQQCMAYEPGQRPSFRAVIRDLNSL
ITSDYELLSDPTPGTLAPRDGLWNGTQLYACQDPTIFEERHLKYISQLGKGNFGSVELCR
YDPLGDNTGALVAVKQLQHSGPEQQRDFQREIQILKALHSDFIVKYRGVRYGPGRQSLRL
VMEYLPSGCLRDFLQRHRARLDAGRLLLYASQICKGMEYLGSCRCLHRDLAARNILVESE
THVKIADFGLAKLLPLDKEYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYEL
FTYSDKNCSPSAEFLRMMGCERDVPALCRLLELLAEGQRLPAPPACPSEVHELMKLCWAP
NPQDRPSFSALGPQLDALWSGSRG
NT seq 3315 nt   +upstreamnt  +downstreamnt
atggcacctccaagtgaggagacacccctgatttctcagcgctcctgcagcctctcctct
tcagaggctggtgccctgcatgtgctgctgccccctcggggccctggacccccacagtgc
ctgtccttctcctttggggaccactcagctgaagacctgtgtgtttgcgctgctaaggcc
agtggcatcctgcccgtgtaccactccctctttgctctggctttggaagacctgtcctgc
tggttccccccgagccacatcttctccgtggaggacacgggtacccaggtcctcgtctac
aggctccgcttttacttccctaactggtttggactagagaagtgccaccgatttgggcta
cgaaaggacttgaccagcgccatcttggatctgccagtcctggagcacctctttgctcag
caccgccatgacctggtgagcggccgcctccgggtaggcctcagcctcaaggaacagggt
gagtgtctcagcttggctgttctggacctggcccggatggccctcgagcaggctcagcgg
cccgaggagttgctgaagacggtcagctacaaggtctgcctgccccctggcctacgcgac
ctgatccagggtttgagcttcgtgactcggaggcgcatccgaaggacagtgtgccgggcc
ttgcgcggcgtggcgacctgccaggctgacaggcactcgctcatggtcaagtacatcatg
gacctcgagaggctggatccagacagggctgccgagaccttccgcgtgggtctccccggc
gctgctggtggtcaggatacgccggggctgctccgtgtggctggtggcagtggcatcgcc
tggagcccaggagaacacgaggtcctccagcccttctgcgactttccagaaatcgtggat
atcagcatcaagcaggcgccgtgcattggcccggctgccgagcaccgcctggtcaccatc
accaggacagacaatcagatcctggaggccgagttcccggggcttcccgcagcgttgtcc
ttcgtggcgctcgtggatggctacttccggctgaccacggactcgaggcactacttctgc
aaggaggtggcgccaccgcggctgctggaggaggtggctgagcagtgccatggccctatc
accctggattttgccatcaacaaactcaagactgggggctcacttcccggctcctacgtc
ctccgccgcagtccccaggatttcgacagctacctcctaactgtttgtgtcctgaccccc
ctggggccggattataagggctgcctcatccggtgcgaccccacaggaaccttctccctg
gctggccttggccgttcccacagcagtcttcgagagctcctggcagcctgttggaatggt
gggttgcacgtggatggggttgagctgtacctcaccttctgctgcaaccccagacctaaa
gaaaagtccaatctgattgtggtccggagaggctgcaacccacccacatcatcccctgtt
cagccccaattccagtgccagctgagtcagatgacgtttcacaagatccctgctgacagc
ctgcagtggcatgagaacctaggtcatgggtccttcaccaagatttatcggggctgtcac
catgagattgtggatggggaggcccgagagacagaggtactgctcaaagtgatggatgcc
aagcacaagaattgcatggagtcattcctggaagcagcgagcttgatgagccaagtgtca
taccagcatctcgtattgctccacggcgtgtgcatggctggagacagtatcatggttcag
gaatttgtacgcctgggagcactggacacatatctacgcaagtgtggccacctagtgcca
gccagctggaagctacaggtgatcaaacagctggcctatgccctcaactatctggaagac
aaaggtctccctcatggcaatgtctcagcccggaaggtgctcttggctcgtgaggggact
gatgggaacctgcctttcatcaagctgagtgacccgggtgtcagccccactgtgctaagc
ctggagatgctcactgacaggatcccctgggtggcccctgaatgtctccaggaggcccga
acacttggcttggaagctgacaagtggggctttggagccacagtctgggaggtgttcagt
ggtgtcacagtgcccatcagcaccctggagcctgccaagaagctccagttttaccaggaa
cggcagcagttgcctgcccctaagtggatggagctggccctgctgatccaacagtgcatg
gcctatgagccaggccagaggccctctttccgtgctgtcatccgtgacctgaacagcctc
atcacttcagattatgagctcctctcagaccccacacctggcaccctggcgccccgtgat
gggctctggaatggtacccagctctacgcctgccaggaccctaccatctttgaagagaga
cacctcaaatacatctcacagctgggcaagggcaactttggcagcgtggaactgtgccgc
tacgacccgctgggcgacaacacaggggccctggtggccgtgaagcagttgcagcatagt
gggccagaacagcagagggacttccagcgggagatccagatcctcaaagccctccacagt
gacttcattgtcaagtaccggggtgtacgctatggcccaggccgccagagcctgcggttg
gtcatggagtatctgcccagtggctgcctgcgcgacttcctgcagcggcaccgcgcccgc
ctcgacgctggccgcctgctcctctacgcctcacagatctgcaagggcatggagtacctg
ggctcctgccgctgcctgcaccgcgacctggcagcccggaacatcctggtggaaagcgag
acgcacgtcaagatcgccgacttcggcctcgccaagctgctgcctctcgacaaagagtac
tacgtggtccgcgagccaggccagagccccatcttctggtatgccccagagtccctctcg
gacaacatcttctcgcgccagtcggatgtctggagcttcggggtcgtcctgtacgagctc
ttcacctacagtgacaagaactgtagcccctcagccgagttcctgcggatgatgggatgt
gagagagatgttccagccctctgccgcctcctggagctgctggctgagggccagaggctg
cccgcacctcccgcctgtcctagtgaggttcatgagctcatgaagctgtgctgggcccct
aaccctcaagaccgaccatcattcagtgccctgggcccccagctagatgcgctgtggagt
ggaagccggggatag

KEGG   Bos mutus (wild yak): 102286137
Entry
102286137         CDS       T02919                                 

Gene name
JAK1
Definition
(RefSeq) Janus kinase 1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
bom  Bos mutus (wild yak)
Pathway
bom01521  EGFR tyrosine kinase inhibitor resistance
bom04151  PI3K-Akt signaling pathway
bom04217  Necroptosis
bom04380  Osteoclast differentiation
bom04550  Signaling pathways regulating pluripotency of stem cells
bom04621  NOD-like receptor signaling pathway
bom04630  JAK-STAT signaling pathway
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom05140  Leishmaniasis
bom05145  Toxoplasmosis
bom05152  Tuberculosis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
bom05203  Viral carcinogenesis
bom05212  Pancreatic cancer
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102286137 (JAK1)
   04151 PI3K-Akt signaling pathway
    102286137 (JAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102286137 (JAK1)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102286137 (JAK1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102286137 (JAK1)
   04658 Th1 and Th2 cell differentiation
    102286137 (JAK1)
   04659 Th17 cell differentiation
    102286137 (JAK1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102286137 (JAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102286137 (JAK1)
   05203 Viral carcinogenesis
    102286137 (JAK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102286137 (JAK1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102286137 (JAK1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102286137 (JAK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102286137 (JAK1)
   05161 Hepatitis B
    102286137 (JAK1)
   05160 Hepatitis C
    102286137 (JAK1)
   05171 Coronavirus disease - COVID-19
    102286137 (JAK1)
   05164 Influenza A
    102286137 (JAK1)
   05162 Measles
    102286137 (JAK1)
   05168 Herpes simplex virus 1 infection
    102286137 (JAK1)
   05163 Human cytomegalovirus infection
    102286137 (JAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102286137 (JAK1)
   05169 Epstein-Barr virus infection
    102286137 (JAK1)
   05165 Human papillomavirus infection
    102286137 (JAK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102286137 (JAK1)
   05140 Leishmaniasis
    102286137 (JAK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102286137 (JAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bom01001]
    102286137 (JAK1)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102286137 (JAK1)
Protein kinases [BR:bom01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   102286137 (JAK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 Jak1_Phl FERM_F1 SH2
Other DBs
NCBI-GeneID: 102286137
NCBI-ProteinID: XP_005886754
LinkDB
Position
Un
AA seq 1158 aa
MQYLNIKEDCSAMAFCAKMRSSKKAEMNLEAPEPGVEVLFYLSDREPLRLGGGEYTAEEL
CIRAAQECCISPLCHNLFALYDENTKLWYAPNRTVTVDDKTSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKKVPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMN
RFHPNDSGNVLCYEVMVTGNLGIQWRQKPHIVPVEKEKNKLKRKKLENKHKKDEEKNKIR
EEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT
CFEKSEVLGIQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFVLK
RCCQPKPREISNLLVATKKAQEWQPVYTMSQLSFDRILKKDITQGEHLGRGTRTHIYSGT
LTDYKDDEGTSEEKRIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDV
ENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLL
LAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFGT
TLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAI
MRDINKLEEQNPDIVSEKKPTTEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNT
GEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPS
GSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGD
FGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSD
SSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQHMRKCWEFQPSNRTT
FQNLIEGFEALLRSMSNI
NT seq 3477 nt   +upstreamnt  +downstreamnt
atgcagtatctaaatataaaagaggactgcagtgccatggctttctgtgctaaaatgagg
agctccaagaaggcagagatgaatctggaggcccctgagccgggggtggaggtgctcttc
tacctgtcggatagggagcctctccggctgggcggtggagagtacacggcggaggagctg
tgcattcgggcggcgcaggagtgctgtatctctcctctgtgtcacaacctctttgccctg
tatgacgagaacaccaagctctggtatgctccgaatcgcaccgtcaccgtcgacgacaaa
acgtcactccggcttcactaccggatgaggttctatttcaccaactggcatgggaccaac
gacaatgaacaatcagtatggcgacattctccaaagaagcagaaaaacggctacgagaaa
aaaaaagttccagatgcaacacctctccttgacgccagctcgctggagtatctgtttgct
cagggacagtatgatttggtcaaatgcctggctcccattcgagaccccaagacggagcag
gatgggcacgacattgagaacgagtgtcttgggatggccgtgctggccatctcccactac
gccatgatgaagaagatgcaattgccagaactccccaaggacatcagctacaagcgatat
attccagaaacattgaataagtccatcagacagaggaaccttctcaccaggatgcggata
aataatgttttcaaggattttctaaaggagtttaacaacaagaccatttgtgacagcagc
gtgtccacgcacgacctgaaggtgaaatacctggctaccttggaaactttgacaaaacat
tatggtgctgaaatatttgagacttccatgctactgatttcatcagaaaatgagatgaat
cggttccatccaaatgatagtggaaatgttctctgctatgaagtgatggtgactggaaat
cttggaatccagtggagacagaaaccacatattgttcctgttgaaaaggaaaaaaacaaa
ctgaaacggaaaaaactggaaaataaacacaagaaggatgaggaaaaaaacaaaatccga
gaagagtggaacaatttttcttacttccctgagatcactcacattgtaatcaaggagtct
gtggtcagcattaataagcaggacaacaaaaaaatggaactgaagctctcttcccacgag
gaggccttgtccttcgtgtccctggtcgatggctacttccggctcacggcagacgcccat
cactacctctgcactgacgtggctcccccattgatcgtccacaacatacagaatggctgt
catggtccaatctgcacggagtatgccatcaataagctgcggcaggaggggagcgaggag
gggatgtacgtgctgcggtggagctgcaccgactttgacaacatcctcatgaccgtcacc
tgcttcgaaaagtctgaggtgctgggtatccagaaacagttcaagaactttcagatcgag
gtgcagaagggccgctacagcctgcatggctcggaccgcagcttcccgagccttggggac
ctcatgagccacctaaagaagcagatcctgcgcacggacaacatcagcttcgtgctgaag
cgctgctgccagcccaagccccgagaaatctccaatctgctggtggccaccaagaaagcc
caggagtggcagcctgtctacaccatgagccagctgagtttcgatcgaatcctcaagaaa
gatattacgcaaggcgagcaccttgggagaggcacgcggacacacatctactctgggacc
ctcacggattacaaggatgacgaagggacttctgaagagaagagaataaaagtcatcctg
aaggtcttagaccccagccacagggacatttctctggccttctttgaggcagccagcatg
atgaggcaggtctcccacaaacacatcgtgtacctctatggggtttgcgtccgagatgtg
gagaatatcatggtggaagagtttgtggaggggggacccctggacctcttcatgcaccgg
aaaagtgacgtcctcaccacaccctggaagtttaaagttgccaaacagctggccagcgcc
ctgagttacttggaggataaagacctggtccacggaaatgtgtgcactaaaaacctcctt
ctggcccgcgagggcatcgacagtgagtgcggccccttcatcaagctcagtgaccctggc
atccccatcactgtgctctccaggcaagagtgcatagaacgaatcccctggattgctccc
gagtgtgttgaagactccaagaatctgagtgtggctgctgacaagtggagctttggaacc
acactctgggaaatctgctacaatggcgagatccccttgaaagacaagacgctgattgag
aaagagagattctatgaaagccggtgcaggccagtgaccccatcttgtaaggagctagct
gacttgatgacccgctgcatgaactacgaccccaaccagagacccttcttccgagccatc
atgagagacatcaataagctggaggagcagaatccagacattgtatcagaaaaaaagcca
acaactgaagtggatcccacacattttgaaaagcggttcttaaagaggatccgtgacttg
ggagagggccactttgggaaggtcgagctctgcaggtatgaccctgagggggacaataca
ggggagcaagtggctgtcaaatccctgaagcccgagagtggagggaaccacatcgctgat
ctgaagaaggagattgaaatcttaagaaatctttatcatgagaacattgtgaagtataaa
ggcatctgcacagaagatggtggaaatggtattaagctcatcatggagtttctgccttca
gggagccttaaggaatatcttccaaagaataagaacaaaattaacctcaaacagcaatta
aaatatgccgttcagatttgtaaggggatggactatctgggttctcggcagtacgttcac
cgggacttagcagcaagaaacgtcctcgtggagagtgagcaccaggtgaaaatcggggac
ttcggtctcaccaaagccatcgaaactgataaggagtactacacagtcaaggacgaccgc
gacagccctgtgttttggtatgctccagaatgtttaattcagtgtaagttctatatcgcc
tctgatgtctggtctttcggagtgactctgcatgagctgcttacttactgtgattcagat
tccagtcccatggccttgttcctgaaaatgataggcccaactcatggtcagatgacggta
acaagactcgtgaatacattaaaagaaggaaaacgcttgccatgtccaccgaactgtcca
gatgaggtttatcaacatatgcgaaagtgttgggaatttcaaccatctaatcggacaacc
tttcagaaccttattgaaggatttgaagcacttctaagaagcatgagtaacatttaa

KEGG   Bos mutus (wild yak): 102287266
Entry
102287266         CDS       T02919                                 

Gene name
TYK2
Definition
(RefSeq) tyrosine kinase 2
  KO
K11219  non-receptor tyrosine-protein kinase TYK2 [EC:2.7.10.2]
Organism
bom  Bos mutus (wild yak)
Pathway
bom04217  Necroptosis
bom04380  Osteoclast differentiation
bom04621  NOD-like receptor signaling pathway
bom04630  JAK-STAT signaling pathway
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom05145  Toxoplasmosis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102287266 (TYK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102287266 (TYK2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102287266 (TYK2)
   04658 Th1 and Th2 cell differentiation
    102287266 (TYK2)
   04659 Th17 cell differentiation
    102287266 (TYK2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102287266 (TYK2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    102287266 (TYK2)
   05160 Hepatitis C
    102287266 (TYK2)
   05171 Coronavirus disease - COVID-19
    102287266 (TYK2)
   05164 Influenza A
    102287266 (TYK2)
   05162 Measles
    102287266 (TYK2)
   05168 Herpes simplex virus 1 infection
    102287266 (TYK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102287266 (TYK2)
   05169 Epstein-Barr virus infection
    102287266 (TYK2)
   05165 Human papillomavirus infection
    102287266 (TYK2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102287266 (TYK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bom01001]
    102287266 (TYK2)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102287266 (TYK2)
Protein kinases [BR:bom01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   102287266 (TYK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Jak1_Phl FERM_F2 FERM_F1 Kinase-like Kdo
Other DBs
NCBI-GeneID: 102287266
NCBI-ProteinID: XP_005902973
LinkDB
Position
Un
AA seq 1185 aa
MPLCQWRATTRGRKPSGDGAQPMATREGLKVLLHWAGPSGGEPWVTFTEPTLTAEDVCIH
VAHKVGITPPCFNLFALFDAQAQVWLPPNHILDTSRDSSLTLYFRMRFYFRNWHGTNPQE
PAVYRCGPPGAETSSEQAEQGVQLLDPASFEYLFEQGKHEFVNDVASLWELSSEEEIHHF
QNESLGMALLHLCHLALRNGVPLEKVAKKTSFKDCIPRSFRRQMRQHNALTRLRQRSIFR
KFLRAFQPGCLSQQVVMVKYLATLERLAPCFGTERVPVCHLELLSQADGEPCYIRDGGQA
PPDPGSESAVGPPTHEVLVSGTEGIRWRLVPAEGPADGGAGGGSRMPDADPSGKKMKAEE
VGSEPVDRPRESPWSYFCDFQDITHMVLKERHVSIHCQDNKCLELTLPSRAAALSLVSLV
DGYFRLTADSNHYLCHEVAPPRLLMSIQDGIHGPLLEPFVLAKLKPEAGLYLIHWSTSHL
HRLILTVAQRDQAPGTKGLRLRKFPIELQAGTVMLEGWGRSFPSVRDLRAALQDCSLRAG
NDCFSLRRCCLPRPGEISNLIVTRGPQASTRPLNLSHLSFYRVRQEDITQLSHLGQGTRT
NVYEGLLRVGGGGPEEDKADGEEPPTPAGDRGQELRVVLKVLDPSHHDIALAFYETASLM
SQVSHVHLAFVHGVFVHGSENIMVTEYVEHGPLDVWLRRERGRVPLAWKLAVAQQLASAL
SYLEDKSLVHGNVCGRNILLARLGLAEGTSPFIKLSDPGVGLSALSREERVERIPWTAPE
CLSGGANSLSTAADKWGFGATLLEICFDGEAPLQGRSPSEKERFYQKQHKLPEPSCPELA
TLTSQCLTYEPAQRPSFRTILRDFTQLQPQNLADVLSVSPDSLASDPTVFHKRYLKKIRD
LGEGHFGKVSLYCYDPTNDGTGEMVAVKALKAGCGPQLRTGWRREIDILRTLYHKHIVKY
KGCCEDQGEKSIQLVMEYMPLGSLRDYLPRHNVGLVQLLLFSLQICEGMAYLHTQHYVHR
DLAARNVLLDNNRLVKIGDFGLTKAVPEGHEYYCVREDGDSPVFWYAPECLKECKFYYAS
DVWSFGVLMYELLTYCDSSQSPPSKFIELIGLTQGQMTVLRLTELLERGERLPQPEKCPS
EIYCLMKDCWKAEASFRPTFQNLVPILRSYHEKYQGQAPSVFSVC
NT seq 3558 nt   +upstreamnt  +downstreamnt
atgcctctgtgccaatggagggccaccaccaggggcaggaagcccagtggggacggagct
cagcccatggccaccagagaaggcctgaaagtgcttctgcactgggctggccccagtggt
ggggagccctgggtcaccttcactgagcccacactgaccgcggaggatgtctgcatccac
gtcgcacacaaagtcggcatcactccaccctgcttcaatctttttgccctcttcgatgcc
caggcccaggtctggctgcctccaaatcacattctggatacctccagggactccagcctg
acgctgtacttccgcatgaggttttatttccgaaactggcatggcacgaatcctcaggag
ccagctgtgtaccgctgcgggcccccaggggccgagacttcctcagaacaggcagagcag
ggggtgcaactcctggaccctgcctcctttgagtacctctttgagcagggcaagcatgaa
tttgtaaatgacgtggcatcactatgggagctatccagcgaggaggagatccaccacttt
cagaatgagagcctgggcatggcccttttgcacctctgccacctcgctctccgcaatggt
gtcccccttgaaaaggtggccaagaagaccagcttcaaggattgcatcccacgctccttc
cggcggcagatgcggcagcacaacgctctgacacggctgcgccaacggagcatcttccgc
aagttcctgcgggccttccagccgggctgcctctcccagcaggtcgtcatggtgaagtac
ctggccacgctcgagcgactggcaccctgctttggcacagagcgtgtgcccgtgtgccac
ctggagctgctgtcccaagccgatggggagccctgctacatccgggacggtgggcaggcc
cctcctgaccccgggtctgagtctgctgtcggaccccccacccacgaggtgctggtgtca
ggcacggaaggcatccggtggcggctggtaccggcggaggggcctgctgatggtggtgct
ggtggcggcagcaggatgcctgatgctgacccatctgggaagaaaatgaaggccgaggag
gtgggcagcgagccagtggacaggcctcgggagagcccctggtcctacttctgtgacttc
caggacatcacccacatggtgctgaaggaacgccacgtcagcatccattgtcaggacaac
aagtgcctggagctgaccctgccttcccgggctgcggccctgtccttggtgtcgctggtg
gatggctacttccgcctgactgccgactcaaaccactacctgtgccacgaggtggctcct
ccacggctgctgatgagtatccaggatggtatccacggccccctgctggagccatttgtg
ctggccaagctgaagcccgaggctggcctctaccttatccactggagcaccagccacctc
caccgcctcatcctcacagtggcccagcgcgaccaggctccaggcactaagggcttgcgc
ctgcggaagttccctatcgagctccaggccgggacagtcatgctggagggctggggccgg
tctttccccagcgtgcgggacctgagggctgccctgcaggactgctcgctgcgggccggc
aacgactgcttttccctgcgtcgctgctgcctgccccggcccggagagatctccaacctc
atcgtcacacgggggcctcaggccagcaccagaccgctcaacctcagtcatctcagcttc
taccgagtccgccaggaagacatcacccagctgtcccacttaggccagggcacaaggacc
aacgtgtatgagggcctcttgcgagtggggggcggaggccccgaggaggacaaggcagat
ggcgaggaaccccccacgcccgctggggaccgtgggcaggagcttcgtgtggtgctcaag
gtgctagaccccagtcaccacgacatcgccctggccttctacgagacagccagcctcatg
agccaggtctcccacgtgcacctggccttcgtgcacggcgtcttcgtgcacggctccgag
aacatcatggtgaccgagtacgtggagcacgggcccctggacgtatggctgcggcgggag
aggggccgcgtgcccctggcctggaagttggcagtggcccagcagctggccagcgccctc
agttacctggaagacaaaagcctggttcatggcaacgtgtgtggccggaacatcctgctg
gcacggctggggctggcggagggcaccagccccttcatcaagctgagtgaccccggcgtg
ggcctgagtgccctctccagggaggagcgggtggagcggatcccctggacagcccccgag
tgcctgtctggtggagccaacagcctgagcaccgcagccgacaagtggggctttggtgcc
accctcctggagatctgcttcgacggcgaggcccccctgcagggccgtagtccctctgag
aaagagcgcttctaccagaagcagcacaaactgcctgagccctcatgcccagagctggcc
acactcaccagccagtgcctgacctacgagccagcccagcggccatccttccgcaccatc
ctgcgtgacttcactcagctacagccccagaatctcgctgatgtcttgtctgtgagcccg
gattcactggcttcagatcccacggttttccacaagcgatacttgaaaaagatccgggat
ctgggtgagggtcacttcggaaaggtcagcctgtattgctacgaccccaccaacgacggc
actggtgagatggtagccgtgaaggccctcaaggcaggctgcggtccccagctccggacg
ggctggaggcgagaaatcgacatcctacgcacgctctaccacaagcacatcgtcaagtac
aagggctgctgcgaggaccaaggcgagaagtcgatacagctggtcatggaatacatgccc
ctgggcagcctccgagactacttgccccggcacaatgtcgggctggtccagctgctgctc
ttctccctgcagatctgcgagggtatggcctacctgcacacacagcactacgtgcatcga
gacctggccgcgcgcaacgtgctgctggacaacaacaggctagtcaagatcggggacttc
ggcctcaccaaggccgtgcccgaaggccacgagtattactgcgtgcgcgaggatggggac
agtcctgtgttctggtatgccccggagtgcctgaaggagtgtaagttctactatgcatca
gacgtctggtcctttggggtcctcatgtatgagctgctgacctactgtgactccagccag
agccctccctcgaaattcatcgagctcataggcctcacccaagggcagatgactgtgctg
aggctcacagagctgctggaacgaggggagaggctgccgcaaccagagaaatgcccctct
gagatctattgcctcatgaaggactgctggaaggcagaggcctcattccgcccgaccttc
cagaacctcgtacccatcctcagatcataccacgagaaataccaaggccaggccccctcg
gtgttcagtgtctgctga

DBGET integrated database retrieval system