KEGG   Bos mutus (wild yak): 102278828
Entry
102278828         CDS       T02919                                 

Gene name
GPR87
Definition
(RefSeq) G protein-coupled receptor 87
  KO
K08389  G protein-coupled receptor 87
Organism
bom  Bos mutus (wild yak)
Brite
KEGG Orthology (KO) [BR:bom00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bom04030]
    102278828 (GPR87)
G protein-coupled receptors [BR:bom04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    102278828 (GPR87)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx Saf_2TM Ctr
Other DBs
NCBI-GeneID: 102278828
NCBI-ProteinID: XP_005904849
LinkDB
Position
Un
AA seq 358 aa
MGLNLTLAKLPDNELHGPGNHTPSNTSDGSGKNTTVHNEFDTIVLPGLYLVIFVASILLN
GLAVWIFFHIRNKTSFIFYLKNIVVADLIMTLTFPFRIVHDAGLGPWYFKFILCRYSSVL
FYANMYTSIVFLGLISIDRYLKVVKPFGDSRMYSITFTKVLSVCVWVLMAVLSLPNIILT
NVQPTRENIHECTKLKSPLGVKWHNAITYINSCLFVVVLVILIGCYIAISRYIHKSSRQF
ISQSSRKRKHNQSIRVVVAVFFTCFLPYHLCRIPFTFSHLDRLLDESAHKILYYCKEMTL
FLSACNVCLDPIIYFFMCRSFSRRLFKKSNIRTRSESIRSLQSVRRSEVRIYYDYTDV
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggggctcaacttgacacttgcaaaattaccagataatgagctgcatggcccagggaat
cacaccccaagtaacacaagcgatggatctggaaagaacaccaccgttcacaacgaattc
gacactatcgtcttgcctgggctttacctcgttatattcgtggcaagcatcttgctgaat
ggtctagcagtatggatcttctttcacattaggaataaaaccagcttcatattttatctc
aaaaacatagtggttgccgacctcataatgacactgacgtttccatttcgaatagtccat
gatgcaggacttggaccttggtacttcaagtttatcctctgcagatactcttcggtttta
ttttacgccaacatgtatacttccattgtgtttctcgggctgataagcattgatcgctac
ctgaaggtggtaaagccatttggcgactctcgcatgtacagcataacctttacaaaggtt
ttatctgtctgtgtttgggtgctcatggctgtcctgtccttgccaaacatcattctaacc
aatgtccaaccaactagggaaaatattcatgagtgcacgaaacttaagagtcctctggga
gtgaaatggcataatgccatcacttacatcaacagctgcttgttcgtggttgtgctggtg
atactgatcgggtgttacattgccatttccaggtacattcacaaatccagcaggcaattc
ataagccagtcaagccgaaagcgaaaacacaaccagagcattagagtggtcgtggctgtg
ttcttcacctgttttctaccctatcacttgtgtaggattccctttactttcagtcacttg
gacagacttttagatgagtcggcacacaaaatcctgtattactgcaaagaaatgacactt
ttcttgtctgcgtgcaacgtgtgcctggacccaatcatttactttttcatgtgtcgctca
ttttcaagaaggctattcaaaaaatcaaacatcagaacgaggagcgaaagcatccgatca
ctacagagtgttagaagatccgaggtccgcatatactatgattatactgacgtgtag

DBGET integrated database retrieval system