KEGG   Bos mutus (wild yak): 102279174
Entry
102279174         CDS       T02919                                 

Gene name
AIM2
Definition
(RefSeq) absent in melanoma 2
  KO
K12966  absent in melanoma 2
Organism
bom  Bos mutus (wild yak)
Pathway
bom04621  NOD-like receptor signaling pathway
bom04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102279174 (AIM2)
   04623 Cytosolic DNA-sensing pathway
    102279174 (AIM2)
SSDB
Motif
Pfam: HIN Borrelia_orfX
Other DBs
NCBI-GeneID: 102279174
NCBI-ProteinID: XP_014334074
LinkDB
Position
Un
AA seq 253 aa
MNRNGMYLQLEETQCEKHLWQEFDFLKGLKDNGGGCGTENLRRVKGKQEMCHAAVSTESE
FFLVKVFNSKLKDKFTPSKIIMISKYYWHSCFLEVMLISLVCDTEFDQISVSKHIIRKDG
DTSDYQKFGVGFIFSESRTEDHILCDLNDSTGMIEVLMLGNEEKIQCKERNKLQLTFLEL
SKTGEKLYLKSRRNSMLCSITMLAPYTSNEKSHTAKLKKLLVIALLVDSYIFDSLHKVSI
LTVYNLMNYDKWM
NT seq 762 nt   +upstreamnt  +downstreamnt
atgaacaggaatggaatgtatcttcagttagaggaaacacagtgtgaaaaacacctgtgg
caggagtttgactttcttaagggtttgaaagacaatgggggtggctgtggtacagagaat
ctccgaagggtgaaagggaagcaggagatgtgtcatgctgcagtgtctactgagagtgaa
ttctttcttgtaaaagttttcaatagcaaactgaaggataaattcactccaagcaaaata
attatgatatcaaaatattattggcacagttgtttcctggaagtgatgctgatttccctg
gtgtgtgacactgaatttgaccagatcagtgtctcaaagcatattatcagaaaagatggt
gatacttcagattaccaaaagtttggtgttggttttatcttttcagaaagcagaacagaa
gatcatatattatgtgacctaaatgacagcacaggaatgatagaagtactgatgcttgga
aatgaggagaaaatccagtgcaaggaacggaataaacttcaacttacattcttagagcta
tcaaagactggagaaaaactatacctgaaatctagaaggaacagcatgctctgttccata
acaatgctggctccatacaccagcaatgaaaaatcccataccgccaagctaaagaaatta
ttagtaattgctctacttgtagactcctacatcttcgactcattgcacaaggtatcaatc
ctcacggtttacaacctaatgaactatgacaaatggatgtag

DBGET integrated database retrieval system