KEGG   Bos mutus (wild yak): 102279316Help
Entry
102279316         CDS       T02919                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease, serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
bom  Bos mutus (wild yak)
Brite
KEGG Orthology (KO) [BR:bom00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bom01002]
    102279316 (TMPRSS9)
Enzymes [BR:bom01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     102279316 (TMPRSS9)
Peptidases [BR:bom01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102279316 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2 Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 102279316
NCBI-ProteinID: XP_005888448
LinkDB All DBs
Position
Un
AA seq 1089 aa AA seqDB search
MEPTASDLQLVPGATKDVLAADAMCCRAALSTVVATSIVLVTLGVLVASLSTQGVDVEHM
AELRGIRFAPSLQQETSEYYRTLTPALEMLLHFLLLALWTPSPGLEEQLLQRGLHARLQG
LGIPLAPYGTIVSAQLTGSQKGPLTERDLKSGHCPGNVFSCGNSQCVTKVNPECDDTADC
SDGSDEAHCDCGLQPGWKTAGRIVGGVEASPGEFPWQVSLRENNEHFCGAAIISARWLVS
AAHCFNEFQDSPEWVAYVGTTYLSGSEASTVRARVARIITHPSYNSDTADFDVAVLELGR
PLPFSRHVQPVCLPAASHIFPPRKKCLISGWGYLKENFLVKPEMLQKATVELLDQALCTS
LYGHSLTDRMVCAGYLDGKVDSCQGDSGGPLVCEESSGRFFLAGIVSWGIGCAEAQHPGV
YARVTSLRDWILETIASASKPPAPTVALASTTLSTAWPTSPKSLVTDTLTKPTLAPSTMP
LDLATASKPQECGARPALEKPTRIVGGLGASLGEVPWQVSLKEGSRHFCGATVVGDRWLL
SAAHCFNHTKVELVRAQLGTASLSGVGGSPVKVGLRRVVLHPQYNPSILDFDVAVLELAR
PLVFNKYVQPVCLPLAIQKFPVGRKCVISGWGNTQEGNATKPDLLQQASVGIIDHKACSA
LYNFSLTDRMICAGFLEGKVDSCQGDSGGPLACEETPGVFYLAGIVSWGIGCAQVKKPGV
YTRITRLKGWILATMSSHLLPTAPLPTTRMPTSSHATRTTAGLTVPGVMASTPTPWATSR
VTSQPADRTITTVTSTPRGQTPLPPAPKTTVGAQLPDCGLAPAAALTRIVGGSAAGRGEW
PWQGTPENSERGASTFARNALSPHSQPRVPPSRKPSLSTHHPKPGCKGPTVLDWHHPKGP
PSYGDPKQWAAFLGTPFLSGADGQLERVARIHKHPFYNLYTLDYDVALLELVGPVRRSHL
VRPICLPEPAPRPPDGARCVITGWGSVREGGSMARQLQKAAVRLLSEQTCRRFYPVQISS
RMLCAGFPQGGVDSCSGDAGGPLACREPSGRWVLTGVTSWGYGCGRPQFPGVYTRVASVR
GWIGQNIQE
NT seq 3270 nt NT seq  +upstreamnt  +downstreamnt
atggagcccactgccagtgacttacagctggtgcctggagccaccaaggacgtcctggct
gcagatgccatgtgctgccgggcggccctgtccactgttgtggccaccagcatcgtcctc
gtcaccctgggagtccttgtggcctccctctctacacagggcgtcgacgtagagcacatg
gctgagctgcgtgggatccggtttgcccccagcttgcagcaggagacctcagagtactac
cgcacgctgacgcccgctctggaaatgctgctgcactttctgctgctggccctgtggacg
ccaagcccaggcctggaggagcagctattgcagcggggacttcatgcgaggctgcagggc
ctcggcatccccctagccccctatggcaccattgtgtctgcccagctcacaggaagccag
aaggggccgctgacagaaagagacttaaaatcaggccactgtccagggaatgtcttttcc
tgcgggaacagccagtgtgtgaccaaggtgaacccagagtgtgatgacaccgcggactgc
tccgacggctccgacgaggcccactgcgactgtggcttgcagcctggctggaagacagct
ggcaggattgtgggtggtgtggaagcgtccccaggggagttcccttggcaagtcagcctc
cgtgaaaacaacgagcacttctgtggggccgccatcatcagcgccaggtggctggtgtcc
gctgcccactgcttcaacgaattccaggactccccggagtgggtagcttacgtgggcacc
acctacctcagtggctcagaggccagcacggtgcgggcccgcgtggcccggatcatcaca
cacccatcctacaactcggacacagctgacttcgacgtggcggtgctggagctgggcaga
cccctgcccttcagccggcacgtgcagcccgtgtgcctgccggctgcctcacacatcttc
ccaccaaggaagaagtgcctcatctcaggctggggctacctcaaggagaacttcctggtc
aagccggaaatgctgcagaaggccactgtggagctgctggaccaggccctgtgcaccagc
ctatacggccactcactcaccgacaggatggtgtgtgctggctacctggacgggaaggtg
gattcctgccagggtgactcggggggccccctggtctgcgaggagtcctccggcaggttc
ttcctggctggcatcgtgagctggggaatcggctgtgcggaagcccagcatccaggggtc
tacgcccgagtgaccagtctgcgggactggatcctagagaccatcgcttctgcaagcaag
cctccagcccccacagtggctctcgcctccaccactctcagcactgcctggcccaccagc
cccaagagcctggtgactgacaccctcaccaaacccacactggcccctagcactatgcct
ctagacttggccaccgcttctaagccacaagagtgtggggccagaccagcgctggagaag
cccactcggatcgtgggggggcttggggcctccttgggggaggtgccttggcaggtcagc
ctgaaggagggctcgcggcacttctgcggagccaccgtggtgggggaccgctggctgctg
tctgccgcccactgcttcaaccacacgaaggtggagctggtgcgggctcagctgggcacc
gcgtccctgtcgggcgttggcgggagccccgtgaaggtggggctcaggcgggtggtgctg
cacccccagtacaaccccagcatcctggacttcgacgtggccgtgctggagctggccagg
cctttggtcttcaacaagtatgtgcagcccgtctgcctgccgctggccatccagaagttc
cctgtgggccgcaagtgtgtgatctccgggtggggcaacacgcaggagggcaacgccacc
aagcctgacctcctgcagcaggcgtctgtgggcatcatagaccacaaggcatgtagcgcc
ctctacaacttctcactcacggacaggatgatctgcgccggcttcctggagggcaaggtg
gattcctgccagggtgactctgggggacccctggcctgtgaggagacacccggtgtgttt
tatctggctgggatcgtgagctggggcatcggctgtgcgcaggtcaaaaagccgggtgtg
tacacccgcatcacccggctcaagggctggatcctggccaccatgtcctcccacttgctc
cccacggccccgctgcccaccacgaggatgcccaccagcagtcatgccaccaggacgaca
gcaggcctcacagtcccgggagtcatggccagcacacccactccctgggccaccagcagg
gtgaccagtcaacctgccgacaggaccatcacaactgtgacctccacccctaggggccag
acaccactgcccccagctccgaagaccacggtgggcgcccagctaccagactgcggcctg
gcgccggctgcggcgctgacccggatcgtgggtggcagcgctgcgggccgcggggagtgg
ccgtggcaggggacccctgaaaattcagagcgtggcgcctccaccttcgcccggaacgcc
ctttccccacactcacagccccgggtccctccttcgcgcaaaccttccctgtctacccac
caccccaaacctggctgcaagggcccaactgtcttggactggcaccaccctaaaggccct
ccaagctacggggaccccaagcagtgggcagccttcctgggcacgccgttcctgagtggc
gctgatgggcagctggagcgtgtggcgcgcatccacaagcaccccttctacaacctctac
acgctcgactacgacgtggcactgctcgagctggtggggccagtacgccgcagccacctg
gtgcggcccatctgcttgcctgagcccgccccacggccccccgacggtgcgcgctgcgtc
atcacaggctggggctctgtgcgcgagggaggctccatggccaggcagctgcagaaggcg
gccgtgcgcctcctcagcgagcagacctgccgccgcttctacccggtacagatcagcagc
cgcatgctgtgtgccggcttcccgcagggaggcgtggacagctgctcgggtgacgctggg
ggacccctggcctgcagggagccctccggccgctgggtgctaactggggtcaccagctgg
ggttatggctgtgggcggccccagttcccgggcgtgtacacccgggtggcttctgtcaga
ggctggatcgggcagaacatccaggagtga

DBGET integrated database retrieval system