KEGG   Bos mutus (wild yak): 102279560
Entry
102279560         CDS       T02919                                 

Gene name
BID
Definition
(RefSeq) BH3 interacting domain death agonist
  KO
K04726  BH3 interacting domain death agonist
Organism
bom  Bos mutus (wild yak)
Pathway
bom01524  Platinum drug resistance
bom04071  Sphingolipid signaling pathway
bom04115  p53 signaling pathway
bom04210  Apoptosis
bom04215  Apoptosis - multiple species
bom04217  Necroptosis
bom04650  Natural killer cell mediated cytotoxicity
bom04932  Non-alcoholic fatty liver disease
bom05010  Alzheimer disease
bom05014  Amyotrophic lateral sclerosis
bom05022  Pathways of neurodegeneration - multiple diseases
bom05152  Tuberculosis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05200  Pathways in cancer
bom05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    102279560 (BID)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102279560 (BID)
   04215 Apoptosis - multiple species
    102279560 (BID)
   04217 Necroptosis
    102279560 (BID)
   04115 p53 signaling pathway
    102279560 (BID)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102279560 (BID)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102279560 (BID)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102279560 (BID)
   05014 Amyotrophic lateral sclerosis
    102279560 (BID)
   05022 Pathways of neurodegeneration - multiple diseases
    102279560 (BID)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102279560 (BID)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102279560 (BID)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102279560 (BID)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102279560 (BID)
   05161 Hepatitis B
    102279560 (BID)
   05160 Hepatitis C
    102279560 (BID)
   05164 Influenza A
    102279560 (BID)
   05162 Measles
    102279560 (BID)
   05168 Herpes simplex virus 1 infection
    102279560 (BID)
   05163 Human cytomegalovirus infection
    102279560 (BID)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102279560 (BID)
   05169 Epstein-Barr virus infection
    102279560 (BID)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102279560 (BID)
SSDB
Motif
Pfam: BID
Other DBs
NCBI-GeneID: 102279560
NCBI-ProteinID: XP_005895269
LinkDB
Position
Un
AA seq 193 aa
MDLKVSNGPSPGDERTTSLLLLGFLQSCPHSCFQRELEALGHELPGHLFHDDELQTDGNR
CSHFPLAAEAETDSERQEEAVREVARQLAQIGDRLEGSIRPGMVAGLASRFSVRSLSEED
RRQCLAAALEQLMQTCPPDMDHEKTQLLLTMLLAKKIADHSPALLRDVFHTTVTFINQNL
LAYVRNLVRNQMD
NT seq 582 nt   +upstreamnt  +downstreamnt
atggatttgaaggttagcaacggccccagccctggggacgagcgcaccacgagcctgctg
ctgctgggcttcctgcagagctgcccccactcctgcttccagagggagctggaggcgctg
ggtcacgagctgcctgggcacctgttccatgatgacgagctgcagacggacggcaaccgc
tgcagccacttccccttggcagcggaagcggagacagattctgagcgtcaggaggaggca
gtccgcgaagtcgcccggcagctcgcccagattggggacaggctggagggcagcatccgc
ccagggatggtggccggcctggcctcacgcttcagtgtcaggagcctgtcggaggaggac
aggaggcagtgcctggcggctgcgctggaacagctcatgcaaacctgccctcctgacatg
gaccacgagaagacccagctcctgctcaccatgctcttggccaaaaagatagccgaccac
tcgccagccttgctccgagatgtcttccacacaacggtgaccttcatcaaccagaacctc
ctcgcctacgtgaggaacttagtccgaaatcagatggactga

DBGET integrated database retrieval system