KEGG   Bos mutus (wild yak): 102279578Help
Entry
102279578         CDS       T02919                                 

Gene name
LCT
Definition
(RefSeq) lactase
  KO
K01229  lactase-phlorizin hydrolase [EC:3.2.1.108 3.2.1.62]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00052  Galactose metabolism
bom01100  Metabolic pathways
bom04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:bom00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    102279578 (LCT)
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    102279578 (LCT)
Enzymes [BR:bom01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.62  glycosylceramidase
     102279578 (LCT)
    3.2.1.108  lactase
     102279578 (LCT)
Chaperones and folding catalysts [BR:bom03110]
 Intramolecular chaperones
  Others
   102279578 (LCT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 102279578
NCBI-ProteinID: XP_005899554
LinkDB All DBs
Position
Un
AA seq 1923 aa AA seqDB search
MELAWHLVLTVLLSFSCWGLDWDSDKNFISAAGPLTNSLLHNLRDPLGNQASPFVAEDEE
IYVCRQPLPGFLRSVRASMITHYKVFLPWAQLLPEGISENPDKGTVLCYRQLLEALKTAQ
LQPLVVLHHQTLPASTLQRTEAFADLFVAYASFAFHSFGDLVEIWFTFSDLERVITKLPH
QESRSSRLQMLTDAHRKAYEIYHEKYASQGGKLSVVLRAETLSKLLLEPSMSTLVKDAVD
FISLDLSYECHSEADLPQTLSELQTTEPKVKVFVFSLKLQNCLSTRNNVAHLLFSLLKAI
NEDQMLVIGFDISTFLSCSSSSKKSWSCSLSDSLTLQTAPQLGPDTAVYAWPPRSAYQRV
WEAFANQSKAERDAFLQDVFPEGFLWGVSTGAFNVEGGWAEDGRGPSIWDRVGHQNTNKG
QATPEVASDSYHKADTDVALLRGLQAQVYKFSISWSRIFPTGQGRNPNPRGVAYYNKLID
SLLDSHIEPMATLFHWDLPQALQDRGGWQSEDVVDAFLDYAAFCFSTFGDRVKLWVTFHE
PWVMSYAGYGTGQHAPGISDPGVASFKVAHMVLKAHARAWHHYNSHHRPQQQGRVGIVLN
SDWAEPLSPERPEDLRAAERFLHFMLGWFAHPIFVDGDYPAALRAQIQQMNKQCPSPVAQ
LPEFTEAEKQLLKGSADFLGLSHYTSRLISKARGDTCIPSYDTIGGFSQHVDPTWPQTAS
PWIRVVPWGIRRLLNFVSLEYTKGKVPIYLAGNGMPIGESEDLIDDSLRVDYFNQYINEV
LKAIKEDSVVVQSYIARSFIDGFEGPSGYSQRFGLYHVNFDDSSRPRTARKSAYFFTSMI
EKNGFLNKVVKRQSPPSIANIPRKIRAFSFPSEVPSKAKVVWEKFSNQPKFERDLFYHGT
FHDDFLWGVSSSAYQIEGAWDADGKGPSIWDNFTHTPGSNVKDNATGDVACDSYNHLDAD
LNMLQALKVKAYRFSISWSRIFPTGRNTSVNAHGVDYYNKLINGLVENNISPMVTLFHWD
LPQALQDIGGWENPFVVDLFNSYADFCFQTFGDRVKFWMTFNEPTYQAWLGYGSGEFPPN
VNDSGSGPYRIGHAIIKAHARVYHTYDEKYRQEQKGVISLSLSSHWAEPQSLVPRDVEAA
DRMLQFSLGWFAHPIFRNGDYPDAMKWKVGNRSELQHLATSRLPSFTEEEKQYIAATADV
FCLNTYSSRIVQHTTPRLNPPSYTSDQELLEWEDTSWPATAMNRAAAWGMRRLLNWIKEE
YGDIPVYITENGVGLTDPKLEDTDRIFYHKTYINEALKAYRLDGVNLRGYAAWSLMDSFE
WLNGYTVKFGLYHVDFDDVNRSRTARASARYYTEVITNNGMPLSKEDEFLYGQFPKDFIW
SAATASYQIEGAWRADGKGLSIWDTFSHTPLKVENNDTGDVACDSYHKIAEDLAALQTLG
VTHYRFSISWTRILPDGTNKHVNEAGLDYYVRLIDTLLAANIQPQVTIYHWDLPQALQDV
GGWENETIVQRFKEYAEVLFQRLGDKVKFWITLNEPYVVAYQGYGYGTAAPGISFRPGTA
PYIVGHNLIKAHAEAWHLYNDVYRARQGGVISITISSDWAEPRDPSNQEDVEAAKRYVQF
MGGWFAHPIFKNGDYPEVMKTRIRDRSLAEGLNKSRLPEFTESEKRRINGTYDFFGFNHY
TTVLAYNLNYASWISSFDADRGVASITDRSWPDSGSFWLKMTPFGFRRILNWLKEEYNNP
PIYVTENGVSHRGEANLNDTARIYYLRSYINEALKAMQDKVDLRGYTVWTLMDNFEWATG
FSDKFGLHFVNYTDPALPRIPRESAKVYASIIRCSGFPDPAAGPHPCLQQEDAEPTASPV
RQNIQFLGLRLSTTQAQTALNVLFAFMLLGVCCVALLSYKYFKRSKQKHTQPGEQELSHR
SSF
NT seq 5772 nt NT seq  +upstreamnt  +downstreamnt
atggagctggcctggcatttagtccttactgttcttttaagtttttcttgctggggttta
gactgggactctgataaaaatttcatctcagctgctggtcctctaaccaacagcttgcta
cacaacctgagagatcccctgggaaaccaggcttctccctttgtagcagaagatgaagaa
atttacgtttgtcgccagccactgcctggattcctgagaagtgtccgcgccagtatgatc
acccattacaaagtatttctgccatgggcacaacttctcccagaaggaatctcggagaac
ccagacaagggaacagtgctgtgctatcggcaactgcttgaggccctcaagactgctcag
cttcagcccttggtggttctacaccaccagaccctccctgccagcactctccagagaact
gaggcctttgccgatctctttgtggcctatgcctcctttgccttccactcctttggggac
ctagttgagatctggttcacttttagtgatttggagagagtgatcacgaagcttccccac
caggaatcaagatcttcacgtctgcagatgctcactgatgcccacagaaaagcctatgag
atttaccatgaaaaatatgcttctcaaggtggaaaactctctgtggtcctgcgagctgag
acgctctccaagctcctgctagaaccatctatgtctacacttgtcaaggatgcagttgac
ttcatctctcttgatttatcttatgaatgccacagtgaggcagatttaccacagacgttg
agtgaactgcagaccactgaaccaaaagtgaaagttttcgtcttcagcctgaaactccag
aactgcctctccaccaggaacaacgtagcccatctgctcttcagcctgctcaaagccata
aatgaagaccaaatgctcgtcattgggtttgatattagtacattcctgagctgttcatcg
agttccaagaaaagctggtcttgttctctgagtgacagcctgaccctccagactgccccg
cagctgggcccagacacagcagtatacgcctggccgccccgctcagcctatcagagggtc
tgggaagcgtttgccaaccagtccaaggcagaacgggatgctttcctgcaggatgttttt
cctgaaggcttcctctggggtgtctccacgggagcttttaacgtggaaggaggctgggcc
gaggatggaagagggccgagcatctgggacagagttgggcaccagaacaccaacaagggc
caagcaacgccagaggtggccagcgacagttaccacaaggcagacactgacgttgccctg
ctccgtggcctccaggcccaggtctacaagttctccatctcctggtccagaatcttcccc
actgggcaggggcgtaaccccaacccccggggtgttgcctactacaacaaactgattgac
agcctgctggactcgcacatcgagcccatggccaccctgttccactgggacctgccccag
gccctgcaggatcgtggtgggtggcagagtgaagatgtggtggacgccttcctggactat
gcagccttctgcttctccacgtttggggaccgtgtgaagctatgggtgaccttccacgag
ccgtgggtgatgagctacgcgggctacggcaccggccagcacgcaccgggcatctccgac
ccaggggtggcctcttttaaggtggcccacatggtcctcaaggcgcacgccagggcttgg
caccactacaacagccaccaccgcccacagcagcaggggcgtgtgggcatcgtgctgaac
tcggactgggcagaacccctgtccccggagaggcctgaggacctgagagccgccgaacgc
ttcctgcacttcatgctgggctggtttgcacaccccatctttgtggatggggactacccg
gctgccctgagggcccagattcaacagatgaacaagcagtgccccagtcctgtggcccag
ctccctgagttcaccgaggcagagaaacagctcttgaaaggctctgctgattttctgggt
ctgtcccattacacttcccgcctcatcagcaaggcccgaggagatacctgcatccccagc
tatgataccatcggaggcttctcccagcatgtggaccccacatggccccagaccgcatcc
ccttggattcgtgtggtgccctggggcataaggaggctgttgaactttgtatccttggaa
tacacaaaaggcaaagttccaatctacctagctgggaacggcatgcccataggggagagt
gaagacctcatcgatgattccctgagagtcgactacttcaaccagtatatcaatgaggtg
ctcaaggctatcaaagaagactcggtggttgttcagtcttacatcgctcgctccttcatt
gatggctttgaaggcccttctgggtatagccagaggtttgggctgtaccacgtcaacttc
gatgacagcagcaggccaaggactgccaggaaatctgcctattttttcaccagcatgatt
gaaaaaaatggtttcctcaacaaggtagtaaaaagacagtcaccacccagcatagcaaac
atcccccggaaaatcagagccttctcttttccatccgaggtgccctccaaggcaaaagtg
gtctgggagaagttctccaaccaacccaagtttgagagagatctgttctaccacggcaca
ttccacgatgactttctgtggggcgtgtcctcgtcagcctatcagattgaaggagcttgg
gacgctgacggcaaaggccccagcatctgggacaactttacccacacaccagggagcaac
gtgaaagacaatgccactggagacgtggcctgtgacagctataaccacctggatgccgac
ctgaacatgctccaagcattgaaggtgaaggcttatcgcttctccatctcctggtctcgg
attttcccaactgggagaaacacttctgtcaacgcacatggtgtggattattacaacaag
ctgatcaacggcttggtggaaaacaacatctctcccatggtgaccctgttccactgggac
ctgccccaggccctgcaggacatcggaggctgggagaatcctttcgtggttgacttgttc
aacagctatgcagacttctgcttccagacctttggtgacagagtcaagttctggatgact
tttaatgagcccacgtaccaggcctggttgggatatggctcaggggaatttcccccaaat
gtgaatgactcaggcagtggaccttacaggattggccatgcaatcatcaaagctcatgcc
agagtctatcacacatacgacgagaagtacaggcaagagcagaagggggtcatctccttg
agcctcagttcccactgggcagagccccagtcgctggtccccagggacgtggaggcagct
gaccggatgctgcagttctccttgggttggtttgcccaccccatcttccgaaacggagac
taccccgatgccatgaagtggaaggtggggaacaggagtgaactgcagcacttggccacc
tcccgcctgcccagcttcacggaggaggagaagcagtacatcgcagctaccgccgacgtg
ttctgcctcaacacttactcctccaggattgtgcaacacacgacacccaggttaaaccca
ccctcctacacaagtgaccaggagctgctggagtgggaggacacttcctggcctgccaca
gccatgaacagggctgccgcctgggggatgcggagactgctcaactggatcaaggaagag
tatggggacatccccgtttacatcactgagaacggagtggggctgacagaccccaaactg
gaagacaccgacaggatattttaccacaaaacctatatcaatgaagctttgaaagcctac
agacttgatggtgtcaaccttcgaggatatgctgcctggtccctgatggacagctttgag
tggctgaatggctacacggtcaagtttggactgtaccatgttgattttgatgacgtgaac
aggtctcgcacagcaagagcctcagccaggtactacacagaggtcatcaccaacaatggc
atgccgctgtccaaagaggatgagttcctatacggacagttccccaaggacttcatctgg
agtgcagctaccgcctcatatcagatcgaaggtgcatggagagcagacggcaaaggactc
agtatctgggacacgttttctcacacacccctgaaggttgagaacaatgacacaggagac
gtggcctgtgacagttaccacaagatcgccgaggacctggccgccctgcagaccctgggc
gtgacccactatcgcttttccatctcttggactcgcatcctccccgacgggaccaacaag
cacgtcaacgaggcgggcctggactactacgtgcggctcatcgacacgctgctggccgcc
aacatccagccccaggtgactatttaccactgggacctgccccaggcactccaggatgtt
gggggctgggagaatgagacaattgtacagcggtttaaggagtatgcagaggtgctgttc
cagaggctgggggacaaggtgaagttttggatcacactgaacgagccctatgtcgttgct
taccagggctacggctacgggacggcagctccagggatctcctttaggcccggcactgcc
ccctacattgttggccacaacctgataaaggctcacgctgaggcctggcatctgtacaat
gacgtgtaccgtgcccggcaaggtggcgtcatctccatcaccatcagcagcgactgggct
gagcccagagacccctccaaccaggaggatgtggaggcagccaagagatacgttcagttc
atgggaggctggttcgcacatccgatattcaagaatggggattaccctgaggtgatgaag
acgcggatccgtgacaggagcttagcggaaggcctcaacaagtctcggctccctgagttc
acggagagtgagaagaggaggatcaacggcacctacgacttttttgggttcaatcactac
accactgtcctggcctacaatttaaactatgcctcttggatctcttccttcgatgcagac
aggggagtggcctccatcacagaccgctcctggccagactccggctccttctggctgaag
atgaccccttttggcttcaggaggatcctgaactggttgaaggaggaatacaacaacccc
ccgatctatgtcacagagaacggagtctcccatcggggagaagcaaacctcaatgacact
gcaaggatctactacctccgcagctacatcaacgaggcgctcaaagctatgcaggataag
gtggaccttcgaggatacacggtttggactctgatggacaacttcgagtgggccaccggc
ttctcagataagtttggtttgcattttgtgaactatactgaccctgctctgccaaggatc
cccagagagtcagccaaggtctacgcctccataatccggtgcagtggcttccccgaccct
gctgcagggccacatccttgtcttcagcaagaagatgctgagcccaccgccagccccgtg
agacagaacattcagttcctgggcctcaggctgagtacgacgcaagcccagacagcgctt
aatgtgctctttgctttcatgcttcttggagtctgttgtgttgcacttctgtcctacaag
tattttaagcgctccaagcaaaagcacacacaaccaggtgaacaggaattgagccacagg
tcttcattctga

DBGET integrated database retrieval system