Bos mutus (wild yak): 102279684 Help Entry 102279684         CDS       T02919                                  Symbol CENPX, STRA13 Name (RefSeq) centromere protein X   KO K15360   centromere protein X Organism bom  Bos mutus (wild yak) Pathway bom03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:bom00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     102279684 (CENPX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:bom03400]     102279684 (CENPX) DNA repair and recombination proteins [BR:bom03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      102279684 (CENPX) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-X CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  102279684 NCBI-ProteinID:  XP_005905431 LinkDB All DBs Position Un AA seq 79 aa AA seqDB search MEETGAVFRKELVSKLLHLHFKDKKTKVSGDALQLVAELLKIFVVEAAIRSVRQAQAEGL AHVDVEQLEKVLPQLLLDF NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaggaaaccggagccgtcttccggaaagagctggtgagcaaactgctgcacttgcac tttaaagacaagaagaccaaagtcagtggggatgcgctgcagcttgtggccgagctgctc aagatcttcgttgtagaagcggccattcgcagtgtccggcaggcccaggcagagggcctg gcccatgtggacgtggagcagctggagaaggtgctgcctcagctgcttctggacttctag

DBGET integrated database retrieval system