KEGG   Bos mutus (wild yak): 102279740
Entry
102279740         CDS       T02919                                 

Gene name
BAX
Definition
(RefSeq) BCL2 associated X, apoptosis regulator
  KO
K02159  apoptosis regulator BAX
Organism
bom  Bos mutus (wild yak)
Pathway
bom01521  EGFR tyrosine kinase inhibitor resistance
bom01522  Endocrine resistance
bom01524  Platinum drug resistance
bom04071  Sphingolipid signaling pathway
bom04115  p53 signaling pathway
bom04141  Protein processing in endoplasmic reticulum
bom04210  Apoptosis
bom04211  Longevity regulating pathway
bom04215  Apoptosis - multiple species
bom04217  Necroptosis
bom04722  Neurotrophin signaling pathway
bom04932  Non-alcoholic fatty liver disease
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom05012  Parkinson disease
bom05014  Amyotrophic lateral sclerosis
bom05016  Huntington disease
bom05020  Prion disease
bom05022  Pathways of neurodegeneration - multiple diseases
bom05132  Salmonella infection
bom05152  Tuberculosis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05200  Pathways in cancer
bom05202  Transcriptional misregulation in cancer
bom05203  Viral carcinogenesis
bom05210  Colorectal cancer
bom05212  Pancreatic cancer
bom05213  Endometrial cancer
bom05214  Glioma
bom05216  Thyroid cancer
bom05217  Basal cell carcinoma
bom05218  Melanoma
bom05220  Chronic myeloid leukemia
bom05222  Small cell lung cancer
bom05223  Non-small cell lung cancer
bom05224  Breast cancer
bom05225  Hepatocellular carcinoma
bom05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102279740 (BAX)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    102279740 (BAX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102279740 (BAX)
   04215 Apoptosis - multiple species
    102279740 (BAX)
   04217 Necroptosis
    102279740 (BAX)
   04115 p53 signaling pathway
    102279740 (BAX)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102279740 (BAX)
  09149 Aging
   04211 Longevity regulating pathway
    102279740 (BAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102279740 (BAX)
   05202 Transcriptional misregulation in cancer
    102279740 (BAX)
   05203 Viral carcinogenesis
    102279740 (BAX)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102279740 (BAX)
   05212 Pancreatic cancer
    102279740 (BAX)
   05225 Hepatocellular carcinoma
    102279740 (BAX)
   05226 Gastric cancer
    102279740 (BAX)
   05214 Glioma
    102279740 (BAX)
   05216 Thyroid cancer
    102279740 (BAX)
   05220 Chronic myeloid leukemia
    102279740 (BAX)
   05217 Basal cell carcinoma
    102279740 (BAX)
   05218 Melanoma
    102279740 (BAX)
   05213 Endometrial cancer
    102279740 (BAX)
   05224 Breast cancer
    102279740 (BAX)
   05222 Small cell lung cancer
    102279740 (BAX)
   05223 Non-small cell lung cancer
    102279740 (BAX)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102279740 (BAX)
   05014 Amyotrophic lateral sclerosis
    102279740 (BAX)
   05016 Huntington disease
    102279740 (BAX)
   05020 Prion disease
    102279740 (BAX)
   05022 Pathways of neurodegeneration - multiple diseases
    102279740 (BAX)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102279740 (BAX)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102279740 (BAX)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102279740 (BAX)
   05152 Tuberculosis
    102279740 (BAX)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102279740 (BAX)
   05170 Human immunodeficiency virus 1 infection
    102279740 (BAX)
   05161 Hepatitis B
    102279740 (BAX)
   05160 Hepatitis C
    102279740 (BAX)
   05164 Influenza A
    102279740 (BAX)
   05162 Measles
    102279740 (BAX)
   05168 Herpes simplex virus 1 infection
    102279740 (BAX)
   05163 Human cytomegalovirus infection
    102279740 (BAX)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102279740 (BAX)
   05169 Epstein-Barr virus infection
    102279740 (BAX)
   05165 Human papillomavirus infection
    102279740 (BAX)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102279740 (BAX)
   01524 Platinum drug resistance
    102279740 (BAX)
   01522 Endocrine resistance
    102279740 (BAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bom03029]
    102279740 (BAX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bom02000]
    102279740 (BAX)
Mitochondrial biogenesis [BR:bom03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    102279740 (BAX)
Transporters [BR:bom02000]
 Other transporters
  Pores ion channels [TC:1]
   102279740 (BAX)
SSDB
Motif
Pfam: Bcl-2 CF222
Other DBs
NCBI-GeneID: 102279740
NCBI-ProteinID: XP_005895433
UniProt: L8IM55
LinkDB
Position
Un
AA seq 192 aa
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELGLEQVPQDASTKKLS
ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKL
VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV
LTASLTIWKKMG
NT seq 579 nt   +upstreamnt  +downstreamnt
atggacgggtccggggagcaacccagaggcggggggcccaccagctctgagcagatcatg
aagacaggggcccttttgcttcagggtttcatccaggatcgagcagggcgaatgggggga
gagacacccgagctgggcttggagcaggtgccccaggatgcatccaccaagaagctgagc
gagtgtctgaagcgcatcggagatgaattggacagtaacatggagctgcagaggatgatc
gcagctgtggacacagactctccccgagaggtctttttccgagtggcggctgaaatgttt
tccgacggcaacttcaactggggccgggttgtcgcccttttctactttgccagcaaactg
gtgctcaaggccctgtgcaccaaggtgcccgagttgatcaggaccatcatgggctggaca
ttggacttccttcgagagcggctgctgggctggatccaggaccagggtggttgggacggc
ctcctctcctactttgggacacccacatggcagacagtgaccatctttgtggctggagtg
ctcaccgcctcgctcaccatctggaagaagatgggctga

DBGET integrated database retrieval system