KEGG   Bos mutus (wild yak): 102279771
Entry
102279771         CDS       T02919                                 

Gene name
PLD1
Definition
(RefSeq) phospholipase D1
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00564  Glycerophospholipid metabolism
bom00565  Ether lipid metabolism
bom01100  Metabolic pathways
bom04014  Ras signaling pathway
bom04024  cAMP signaling pathway
bom04071  Sphingolipid signaling pathway
bom04072  Phospholipase D signaling pathway
bom04144  Endocytosis
bom04666  Fc gamma R-mediated phagocytosis
bom04724  Glutamatergic synapse
bom04912  GnRH signaling pathway
bom04928  Parathyroid hormone synthesis, secretion and action
bom05200  Pathways in cancer
bom05212  Pancreatic cancer
bom05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102279771 (PLD1)
   00565 Ether lipid metabolism
    102279771 (PLD1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102279771 (PLD1)
   04072 Phospholipase D signaling pathway
    102279771 (PLD1)
   04071 Sphingolipid signaling pathway
    102279771 (PLD1)
   04024 cAMP signaling pathway
    102279771 (PLD1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102279771 (PLD1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    102279771 (PLD1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102279771 (PLD1)
   04928 Parathyroid hormone synthesis, secretion and action
    102279771 (PLD1)
  09156 Nervous system
   04724 Glutamatergic synapse
    102279771 (PLD1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102279771 (PLD1)
   05231 Choline metabolism in cancer
    102279771 (PLD1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102279771 (PLD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bom04131]
    102279771 (PLD1)
Enzymes [BR:bom01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     102279771 (PLD1)
Membrane trafficking [BR:bom04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    102279771 (PLD1)
 Endosome - Golgi transport
  Others
   Others
    102279771 (PLD1)
SSDB
Motif
Pfam: PX PLDc_2 PLDc PH DUF3785
Other DBs
NCBI-GeneID: 102279771
NCBI-ProteinID: XP_005905643
UniProt: L8I1P3
LinkDB
Position
Un
AA seq 1074 aa
MSLKNEPRVNTSALQKIAADMSNLIENLDTRELHFEGEEVDCDVSPSDPRTQEVYIPFSA
VYKTQGFKEPNIQTYLSGCPIKVQVLEVERFTSTKRVPSINLYTIELTHGEFKWQVKRKF
KHFQEFHRELLKYKAFIRIPIPTRRHTFRRQNVKEEPREMPALPRTSENMIQQEEQFFSR
RKQLEDYLTKLLKMPMYRNYHATTEFLDISQLSFIHDLGPKGIEGMIMKRSGGHRIPGLN
CCGQGRACYRWAKRWLIVKDSFLLYMKPDSGAIAFVLLVDKEFRVKVGRKETETKYGLRI
DNLSRTLILKCNSYRHARWWGGAIEEFIQKYGPDFLRDHRFGSYAAIQGNTLAKWYVNAK
GYFEDVANAMEEAKEEIFITDWWLSPEIFLKRPVVEGNRWRLDCILKRKAQQGVRIFIML
YKEVELALGINSEYSKRTLMRLHPNIKVMRHPDHVSSSVYLWAHHEKLVIIDQSVAFVGG
IDLAYGRWDDNEHRLTDVGSVKRVVGGPSLGSLTAETTESMESLCLRDKNESDKDLPILN
SPDDANSKPKGRKPSKFSKFSLYRQLHRHHLHDTDSISSIDSASSYCNHCRSRQNLIHGL
KPHLKLFRSSSESEQGLTRPNTDTASLRSVQTRVGELHGETRFWHGKDYCNFVFKDWVQL
DKPFADFIDRHSTPRMPWHDIASAVHGKAARDAARHFIQRWNFTKIMKPKYRCLSYPFLL
PKSQTTAHELKYQVPASVHANVQLLRSAADWSAGIKYHEESIHAAYVYVIENSKHYIYIE
NQFFISCSDDRVVFNKIGDAIAQRILKAHRESQRYRVYVVIPLLPGFEGDISTGGGNALQ
AIMHFNYRTMCRGENSILGQLKAEIGNQWINYISFCGLRTHAELEGNLVTELIYVHSKLL
IADDNTVIIGSANINDRSMLGKRDSEMAVIVQDTETVPSVMDGKEYQAGRFAQGLRLQCF
RVVLGYLSDPSEDIQDPVSDKFFKEVWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFI
SKPILAKEDPIRAEEELKKIRGFLVQFPFYFLSEENLLPSVGTKEAMVPMEVWT
NT seq 3225 nt   +upstreamnt  +downstreamnt
atgtcactgaaaaatgagccaagagtaaatacctctgcactgcagaaaatcgctgctgac
atgagtaatttgatagaaaatctggatacgcgagagctccactttgagggagaggaggtg
gactgcgatgtgtctcccagcgatcccaggacacaggaagtgtatatccctttctctgct
gtttataagactcaaggatttaaggagcctaatatacagacgtatctctccggctgccca
ataaaagttcaagttctggaagtggagcgctttacatctacaaaacgggtaccaagcatc
aatctttacactattgaattaacacatggggaatttaaatggcaagtgaagaggaagttc
aagcactttcaagaatttcacagagaactgctcaagtacaaagcctttatccgaatcccc
attcccaccagaagacacacgtttagaagacaaaatgtcaaagaagagcctcgagagatg
ccagctttgccccgcacatctgaaaacatgatccaacaagaagaacagttcttcagtaga
aggaaacagctggaagattacttgacaaagttactaaaaatgcccatgtatagaaactat
catgcaacaacagaatttcttgatataagccagctgtctttcatccatgatttgggacca
aagggcatagaaggtatgataatgaaaagatccggaggacacagaataccaggcctgaat
tgctgtggccagggaagagcctgctatcggtgggcaaaaaggtggttgatagtaaaagat
tcctttttactgtatatgaaaccagacagtggtgctattgccttcgtcctgctggtggat
aaagaattcagagttaaggtggggaggaaggagacagagacgaagtatggactccgaatt
gataatctttcaaggactctgattttaaaatgcaacagctatagacatgctcggtggtgg
ggaggggctatagaagaattcatccagaagtatggccctgactttctcagagatcatcga
tttggatcatatgctgctatccaagggaacactttagccaaatggtatgttaatgccaaa
ggatattttgaagatgtggcaaatgcaatggaagaggcaaaagaagaaatatttatcaca
gactggtggttgagtccagaaatcttcctgaaacgtccggtggttgaaggaaatcgttgg
aggttggactgcattcttaagcgaaaagcacaacagggggtaagaatcttcattatgctc
tacaaagaggtggaacttgcccttggaatcaatagtgaatacagcaagaggactctgatg
cgtctacaccccaacataaaggtgatgaggcacccggatcacgtgtcgtccagcgtatac
ctgtgggctcatcatgagaaactcgtcatcatcgaccagtcggtggcctttgtgggtggg
attgacctggcttatgggaggtgggatgacaacgaacacagactcacggatgtgggcagc
gtgaagcgcgtcgtcgggggaccatccctgggttccctcacagctgaaacaacagagtct
atggaatccttatgcctcagagataaaaatgaatctgataaagatctgcccatcctgaac
tctcctgatgatgcaaattcaaaaccgaaaggaagaaagcccagcaagttctccaaattc
agtctctacaggcagctgcacagacaccatctgcacgacacagacagcatcagcagcatt
gacagcgcctccagttattgtaatcactgtaggagtcgtcagaatttaattcatggttta
aagccccacttgaaactctttcgctcttccagtgagtctgagcaggggcttactagacct
aacactgacacagcctccctccgaagtgtacagacacgtgtgggagagctacatggggaa
acccgattctggcatggaaaggactactgcaatttcgtcttcaaagactgggttcaactc
gataaaccttttgctgatttcattgacaggcactccaccccccggatgccatggcatgac
atagcctctgcagtccacgggaaggcagctcgcgatgcggcccgtcacttcatccagcgc
tggaacttcacgaagattatgaaaccaaaatatcggtgcctttcttatccttttctgctt
ccaaaatctcaaacaacagcccacgagttgaaataccaagtgcctgcgtctgtccatgct
aacgtacagttactccgctctgctgctgattggtctgctggtatcaagtaccatgaagaa
tccatccatgctgcttacgtctatgtgatagagaacagcaagcactatatctatatagaa
aaccagtttttcataagctgctctgatgacagagttgtgttcaacaagattggcgatgcc
attgctcagaggatacttaaagctcacagggaaagccagagataccgggtgtatgttgtg
ataccacttctgccaggttttgaaggagacatttcaaccggcggaggaaatgctctacag
gcaataatgcacttcaactacagaaccatgtgcagaggagaaaattccatccttggacaa
ttaaaagcagagattggcaatcagtggataaattatatatccttctgtggtcttagaaca
catgcagagcttgaaggaaacctagtcactgagcttatctatgtccacagcaagttgcta
attgctgatgacaacactgttattattggctctgccaacataaatgaccgaagcatgctg
ggaaagcgagacagtgaaatggctgtcattgtgcaggacacggagacagtcccttcggta
atggatggaaaagagtaccaagctggtcgatttgcccaaggacttcggcttcaatgcttt
cgggttgttctcggctatctttctgacccgagtgaagacattcaggatccagtgagtgat
aaattcttcaaggaggtgtgggtttcaacagcagctcgaaatgctacaatttatgataag
gtgttccggtgccttcccaatgatgaagtacacaatttaattcagctgagagactttata
agcaagcccatattagcaaaggaggatcccattagagctgaggaagaactgaaaaagatc
cgtgggttcttggtgcaattccccttttatttcttgtctgaagaaaacctactgccttct
gttggaaccaaggaagccatggtgcccatggaggtttggacttaa

KEGG   Bos mutus (wild yak): 102288325
Entry
102288325         CDS       T02919                                 

Gene name
PLD2
Definition
(RefSeq) phospholipase D2
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00564  Glycerophospholipid metabolism
bom00565  Ether lipid metabolism
bom01100  Metabolic pathways
bom04014  Ras signaling pathway
bom04024  cAMP signaling pathway
bom04071  Sphingolipid signaling pathway
bom04072  Phospholipase D signaling pathway
bom04144  Endocytosis
bom04666  Fc gamma R-mediated phagocytosis
bom04724  Glutamatergic synapse
bom04912  GnRH signaling pathway
bom04928  Parathyroid hormone synthesis, secretion and action
bom05200  Pathways in cancer
bom05212  Pancreatic cancer
bom05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102288325 (PLD2)
   00565 Ether lipid metabolism
    102288325 (PLD2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102288325 (PLD2)
   04072 Phospholipase D signaling pathway
    102288325 (PLD2)
   04071 Sphingolipid signaling pathway
    102288325 (PLD2)
   04024 cAMP signaling pathway
    102288325 (PLD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102288325 (PLD2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    102288325 (PLD2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102288325 (PLD2)
   04928 Parathyroid hormone synthesis, secretion and action
    102288325 (PLD2)
  09156 Nervous system
   04724 Glutamatergic synapse
    102288325 (PLD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102288325 (PLD2)
   05231 Choline metabolism in cancer
    102288325 (PLD2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102288325 (PLD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bom04131]
    102288325 (PLD2)
Enzymes [BR:bom01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     102288325 (PLD2)
Membrane trafficking [BR:bom04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    102288325 (PLD2)
 Endosome - Golgi transport
  Others
   Others
    102288325 (PLD2)
SSDB
Motif
Pfam: PLDc_2 PX PLDc PH PH_2
Other DBs
NCBI-GeneID: 102288325
NCBI-ProteinID: XP_005906114
UniProt: L8HY30
LinkDB
Position
Un
AA seq 933 aa
MAATPQSLFPSGDDLDSSQLQMEPDEVDTLKEGEDPADRMHPFLAIYHLQPLKLHPLVFA
PGVPVIAQVVGTERYTSGSKVGTCTLYSVRLTHGDFTWTTKKKFRHFQELHRDLLRHKVF
MSLLPLARFAVASSPAPEGDSREIPSLPRAGPEGSSRRTASKQKYLENYLNRLLTMSFYR
NYHAMTEFLEVSQLSFIPDLGCKGLEGVIRKRSGGHRVPGLTCCGRDQVCYRWSKRWLVV
KDSFLLYMCLETGAISFVQLFDPGFEVQVGKRSTEARYGVRIDTSHRSLILKCSSYRQAR
WWAQEITELAQGPGRDFIQLHRHDSYAPPRPGTLARWFVNGAGYFAAVADAILRAQEEIF
ITDWWLSPEIYLKRPAHSDDWRLDIMLKKKAEEGVHVSVLLFKEVELALAINSGYSKKAL
MLLHPNIKVMRHPDQVTLWAHHEKLLVVDQVVAFLGGLDLAYGRWDDLHYRLTDLGDSSE
SAAPQPPTSCSDLPATPDLTHNQLFWLGKDYSNLITKDWVQLDRPFDDFIDRETMPRMPW
RDIGVVVHGSPARDLARHFIQRWNFTKTTKTKYKIPIYPYLLPKSTSTANQLPFTLSGGQ
CATVQVLRSVDRWSAGTLENSILNAYLHTIRESQHFLYIENQFFISCSDGRTVLNKVGDE
IVDRILKAHKQGQCFRVYVLLPLLPGFEGDISTGGGNSIQAILHFTYRTLCRGEYSILHR
LKAAMGTEWRNYISICGLRTHGELGGHPVSELIYIHSKMLIADDRTVIIGSANINDRSLL
GKRDSELAVLIEDTEMEPSLMNGVEYQAGRFALSLRKHCFSVILGAAARPHLDLRDPVCD
AFFQLWQDTAESNANIYEQIFRCLPSNATRSLRALREYVVVEPLATVSPPLARSELNQVQ
GHLVHFPLKFLEDEYLLPSLGSKEGVMPLEVWT
NT seq 2802 nt   +upstreamnt  +downstreamnt
atggcggcaaccccccagagcctttttccctctggggatgacctggactccagccagtta
cagatggagcccgatgaggtggacaccctgaaggagggagaggacccagccgaccggatg
catccctttctggccatctaccacctccagcctctgaaattgcatcccttggtgtttgcc
cctggggtccccgtcatagctcaggtggtgggcactgaaagatacaccagtggatccaag
gtgggcacgtgcactctgtattctgtccgcttgactcacggtgacttcacctggacaacc
aagaagaagttccgtcatttccaggagttgcatcgggacctcctgagacacaaagtcttc
atgagtctcctccctctggctcgttttgctgttgcttcatctccagccccagagggagac
agcagagagataccctctctaccccgagcaggtcctgagggctcctccagacgtaccgct
agcaagcagaaatacctggagaattatctcaaccgcctcctgaccatgtctttctaccgc
aactaccatgccatgacagagttcctggaagtcagtcagctgtcctttatcccagacctt
ggatgcaaaggattggagggggtgatccggaagcgctcaggtggccaccgcgttcctggc
ctcacctgctgcggccgagaccaagtttgttatcgctggtccaagcggtggctggtggtg
aaggactccttcctgctgtacatgtgcctggagactggcgccatctcctttgttcagctc
ttcgaccctggcttcgaggtgcaggtggggaaaaggagtacagaggcacggtacggggtc
cggatcgacacctctcacaggtccttgattctcaagtgcagcagctaccggcaggcacgg
tggtgggcccaggagatcactgagctggcccagggcccgggcagagacttcattcagctg
caccggcacgacagctatgctcctccccggcctgggaccctagcccggtggtttgtgaat
ggggcaggttactttgctgctgtggcagatgccatccttcgagctcaagaagagattttc
atcacagactggtggttgagtcctgagatttacctgaagcgtccagcccattcagatgac
tggagactggacattatgctcaagaagaaggcggaggagggtgtccatgtgtctgtcctg
ctgttcaaggaagtggagttggccttggccatcaacagtggctacagcaagaaggcactg
atgctgctgcatcccaacataaaggtgatgcgccacccagaccaggtgacactgtgggcc
catcatgagaagctcctggtggtggaccaagtagtggccttcctgggggggctggacctt
gcctatggccgctgggatgacctacactacagactgactgatctgggggactcctctgag
tcagctgccccccagcctcccacctcatgctcagaccttccagctacccccgacctcact
cacaaccaactcttctggctgggcaaggactacagcaatcttatcactaaggactgggtg
cagctggatcggccttttgatgatttcattgacagggagactatgccacggatgccgtgg
cgggacattggggtggtggtccacggctcacctgcccgggaccttgcccggcacttcatc
cagcgctggaatttcaccaagactaccaagaccaagtacaagatacccatttacccctac
ctgctgcccaaatccaccagcaccgcaaaccagctccctttcacactttccggagggcag
tgcgccactgtgcaggtcttacggtcagtggaccgctggtcagcgggcaccctggagaac
tccattctcaatgcctatctgcacaccatcagagagagccagcacttcctctacattgag
aatcagttcttcattagctgctcagatgggcggacagtgctgaacaaggtgggcgatgag
attgtggacagaatcctgaaggcccacaaacaggggcagtgcttccgagtctacgtgctt
ttgcccctgctccctgggttcgagggtgacatctccacaggtggtggtaactccatccag
gccattctgcacttcacttacaggacgctgtgtcgtggggaatattcaattttacatcgt
ctcaaagcagccatggggacagaatggcggaactatatttccatctgtgggctacgcaca
cacggagaactaggcgggcacccagtatcggagctcatctatatccacagcaagatgctt
atcgcagatgaccggacagtcatcattggctcagcaaacatcaatgaccggagcttgctg
gggaagcgagacagtgagctggccgtgctgatcgaggacacagaaatggagccatccctc
atgaacggtgtggagtatcaggcaggcaggtttgccttgagtctgcggaagcactgcttc
agcgtgattctaggggctgctgctcggccacatctggatctccgagaccctgtctgtgat
gccttcttccagttgtggcaagacacagctgagagcaatgccaatatctatgagcagatc
ttccgatgccttccatccaatgccacacgctccctgcgggcacttcgggagtatgtagtc
gtggagcccctggccacggtcagccctcccttggcccgatctgaactcaaccaggtccag
ggccacctcgtccacttccccctcaagttcctggaggatgagtatttgctgccctccctg
ggtagcaaggagggtgtgatgcccctagaagtgtggacatag

DBGET integrated database retrieval system