KEGG   Bos mutus (wild yak): 102279846
Entry
102279846         CDS       T02919                                 

Definition
(RefSeq) interleukin-3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04210  Apoptosis
bom04630  JAK-STAT signaling pathway
bom04640  Hematopoietic cell lineage
bom05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102279846
   04151 PI3K-Akt signaling pathway
    102279846
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102279846
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102279846
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102279846
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102279846
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102279846
   04090 CD molecules [BR:bom04090]
    102279846
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IL3 receptor family
   102279846
CD molecules [BR:bom04090]
 Proteins
  102279846
SSDB
Motif
Pfam: IL6Ra-bind EpoR_lig-bind TAP35_44
Other DBs
NCBI-GeneID: 102279846
NCBI-ProteinID: XP_014333887
LinkDB
Position
Un
AA seq 290 aa
MRYTQIHTADNRRPVGTASPMALPWLAVLLTLICCSMTTDHVKRPSLGSRPRRWAAVRDN
QPLPVVALFSAALAGTPLAAADNLTCRVHDVDQLSCSWAVGEEAPANVQYHFYLKHPLKT
WPCPKYMQNQQGVNVQCHFDGLSLQPERQSQFRFLVNGTSGGSKIPCRQMTHRLEEIEIL
AAPNITKKWCNENYSFMEWEVRSLFTEDIKYELEIQKGADLAYKEEVGIHPVRPPQSAVP
STGSLFPSVSRPSEMKLPSAQTGRYHLHTLLRGCIPRDVVTASSRPTDRI
NT seq 873 nt   +upstreamnt  +downstreamnt
atgcgctatacacagatacacacagctgacaaccgccgtcctgtgggaactgcctcgccc
atggccctcccctggctggccgtgctcctgacactcatctgctgctcgatgaccacggac
cacgttaaacggccgtcgctggggtcacggccgcgccgctgggccgccgtacgagataat
cagccgcttcccgttgtagccctcttctcagccgccttggcgggcacccccctggcggcc
gcggacaacctgacctgccgggtgcacgacgtggatcagctcagctgcagctgggcggtg
ggcgaggaggccccggcgaacgttcaataccatttctatctgaagcaccccttgaagacg
tggccgtgtcccaagtacatgcagaaccagcagggcgtcaacgtccagtgccattttgac
ggcctctcccttcaacctgaacgccaaagtcagttccgtttcctggtgaatggtaccagc
ggtggctccaaaatcccctgccgccaaatgacccatagattggaagaaattgaaatatta
gctgccccgaacatcacaaaaaagtggtgtaacgaaaactactcattcatggaatgggaa
gtaaggagtctctttactgaagacatcaagtatgaacttgagatacagaagggcgcggac
ctcgcctacaaagaggaggtgggtatccatcccgtgcggcccccgcaatctgccgtccca
agcacaggctccttatttccatcagtgtccagaccctctgagatgaagctccccagtgca
cagactgggcgttatcacctacataccctccttcgcggctgcatccctcgggatgtggtg
acagcatcctcacgcccaactgaccgaatctaa

DBGET integrated database retrieval system