KEGG   Bos mutus (wild yak): 102280012Help
Entry
102280012         CDS       T02919                                 

Definition
(RefSeq) histone H3.1
  KO
K11253  histone H3
Organism
bom  Bos mutus (wild yak)
Pathway
bom05034  Alcoholism
bom05202  Transcriptional misregulation in cancer
bom05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:bom00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    102280012
  Immune diseases
   05322 Systemic lupus erythematosus
    102280012
  Substance dependence
   05034 Alcoholism
    102280012
Chromosome and associated proteins [BR:bom03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    102280012
Exosome [BR:bom04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102280012
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 102280012
NCBI-ProteinID: XP_005893954
LinkDB All DBs
Position
Un
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYRPGTVALREIRRFQKSTE
LLIRKLPFQRLVREIAQDFKSDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcccgaacgaagcagactgcccgcaagtccaccggcggcaaagcgcctcgtaagcag
ctagctaccaaagttgctcgaaagagcgctccagccaccggtggcgtgaagaagccacat
cgctatcggcctggaactgtagcactgcgcgagatccgccgcttccagaagtctactgaa
cttctgattcggaagctgccgtttcagcgcctggtgcgggaaattgcgcaggatttcaaa
tccgatctgcgctttcagagttccgccgtgatggcactgcaggaggcatgtgaggcgtat
ctagtcggcctttttgaagacaccaatctgtgtgccatccatgctaagcgtgtcaccatc
atgcctaaggatattcagctggcacggcgaattcgtggagaacgtgcctag

DBGET integrated database retrieval system