Bos mutus (wild yak): 102280497 Help Entry 102280497         CDS       T02919                                  Definition (RefSeq) interferon beta-2   KO K05415   interferon beta Organism bom  Bos mutus (wild yak) Pathway bom04060   Cytokine-cytokine receptor interaction bom04151   PI3K-Akt signaling pathway bom04217   Necroptosis bom04380   Osteoclast differentiation bom04620   Toll-like receptor signaling pathway bom04621   NOD-like receptor signaling pathway bom04622   RIG-I-like receptor signaling pathway bom04623   Cytosolic DNA-sensing pathway bom04630   JAK-STAT signaling pathway bom04650   Natural killer cell mediated cytotoxicity bom04668   TNF signaling pathway bom05135   Yersinia infection bom05142   Chagas disease bom05152   Tuberculosis bom05160   Hepatitis C bom05161   Hepatitis B bom05162   Measles bom05163   Human cytomegalovirus infection bom05164   Influenza A bom05165   Human papillomavirus infection bom05167   Kaposi sarcoma-associated herpesvirus infection bom05168   Herpes simplex virus 1 infection bom05169   Epstein-Barr virus infection bom05170   Human immunodeficiency virus 1 infection bom05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102280497    04668 TNF signaling pathway     102280497    04151 PI3K-Akt signaling pathway     102280497   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102280497  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102280497  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102280497    04621 NOD-like receptor signaling pathway     102280497    04622 RIG-I-like receptor signaling pathway     102280497    04623 Cytosolic DNA-sensing pathway     102280497    04650 Natural killer cell mediated cytotoxicity     102280497   09158 Development and regeneration    04380 Osteoclast differentiation     102280497  09160 Human Diseases   09171 Infectious disease: bacterial    05135 Yersinia infection     102280497    05152 Tuberculosis     102280497   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102280497    05161 Hepatitis B     102280497    05160 Hepatitis C     102280497    05171 Coronavirus disease - COVID-19     102280497    05164 Influenza A     102280497    05162 Measles     102280497    05168 Herpes simplex virus 1 infection     102280497    05163 Human cytomegalovirus infection     102280497    05167 Kaposi sarcoma-associated herpesvirus infection     102280497    05169 Epstein-Barr virus infection     102280497    05165 Human papillomavirus infection     102280497   09174 Infectious disease: parasitic    05142 Chagas disease     102280497  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:bom04052]     102280497 Cytokines and growth factors [BR:bom04052]  Cytokines   Interferons    102280497 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  102280497 NCBI-ProteinID:  XP_005898555 UniProt:  L8IFW6 LinkDB All DBs Position Un AA seq 182 aa AA seqDB search MTYRCLLPMVLLLCFSTTALSRSYSLLRFQQRRSLAVLGQLPSTPQHCLEARMDFQVPEE MNQAQQFRKEDAILVIYEMLQQIFNILTRDFSSTGWSETIIEDLLVELYGQMNRLQPIQK EIMQKQNSTMGDTTVLHLRKYYFNLVQYLKSKEYNRCAWTVVRVQILRNFSFLTRLTGYL RD NT seq 549 nt NT seq  +upstreamnt  +downstreamnt atgacctaccggtgcctcctcccgatggttctcctgctgtgtttctccaccacagctctt tccaggagctacagcttgcttcgattccaacaaaggcggagccttgcggtactggggcag ttaccttcaacgcctcaacattgcctcgaggccaggatggacttccaggtccctgaggag atgaaccaagcacagcagttccggaaggaagatgccatattggtcatctatgagatgctc cagcagatcttcaatattctcaccagagacttctccagcactggctggtctgagaccatc attgaggacctccttgtggaactctatgggcagatgaatcgtctgcagccaatccagaag gaaataatgcagaagcaaaactccactatgggagacacgactgttcttcacctgaggaaa tattacttcaacctcgtgcagtacctgaagtccaaggagtacaacaggtgtgcctggaca gtcgtgcgagtgcaaatactcaggaatttttctttcctgacgagactaacaggttacctc cgtgactga

Bos mutus (wild yak): 102281065 Help Entry 102281065         CDS       T02919                                  Definition (RefSeq) interferon beta-2   KO K05415   interferon beta Organism bom  Bos mutus (wild yak) Pathway bom04060   Cytokine-cytokine receptor interaction bom04151   PI3K-Akt signaling pathway bom04217   Necroptosis bom04380   Osteoclast differentiation bom04620   Toll-like receptor signaling pathway bom04621   NOD-like receptor signaling pathway bom04622   RIG-I-like receptor signaling pathway bom04623   Cytosolic DNA-sensing pathway bom04630   JAK-STAT signaling pathway bom04650   Natural killer cell mediated cytotoxicity bom04668   TNF signaling pathway bom05135   Yersinia infection bom05142   Chagas disease bom05152   Tuberculosis bom05160   Hepatitis C bom05161   Hepatitis B bom05162   Measles bom05163   Human cytomegalovirus infection bom05164   Influenza A bom05165   Human papillomavirus infection bom05167   Kaposi sarcoma-associated herpesvirus infection bom05168   Herpes simplex virus 1 infection bom05169   Epstein-Barr virus infection bom05170   Human immunodeficiency virus 1 infection bom05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102281065    04668 TNF signaling pathway     102281065    04151 PI3K-Akt signaling pathway     102281065   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102281065  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102281065  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102281065    04621 NOD-like receptor signaling pathway     102281065    04622 RIG-I-like receptor signaling pathway     102281065    04623 Cytosolic DNA-sensing pathway     102281065    04650 Natural killer cell mediated cytotoxicity     102281065   09158 Development and regeneration    04380 Osteoclast differentiation     102281065  09160 Human Diseases   09171 Infectious disease: bacterial    05135 Yersinia infection     102281065    05152 Tuberculosis     102281065   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102281065    05161 Hepatitis B     102281065    05160 Hepatitis C     102281065    05171 Coronavirus disease - COVID-19     102281065    05164 Influenza A     102281065    05162 Measles     102281065    05168 Herpes simplex virus 1 infection     102281065    05163 Human cytomegalovirus infection     102281065    05167 Kaposi sarcoma-associated herpesvirus infection     102281065    05169 Epstein-Barr virus infection     102281065    05165 Human papillomavirus infection     102281065   09174 Infectious disease: parasitic    05142 Chagas disease     102281065  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:bom04052]     102281065 Cytokines and growth factors [BR:bom04052]  Cytokines   Interferons    102281065 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon DUF2154 Motif Other DBs NCBI-GeneID:  102281065 NCBI-ProteinID:  XP_005898557 UniProt:  L8IE01 LinkDB All DBs Position Un AA seq 186 aa AA seqDB search MTHRCLLPVVLLLCFSTTALSRSYSLLQFQQRRSLAVCQKLLWQLPSTPQHCLEARMDFQ MPEEMKEEQQFQKEDAILVIYEMLQHIFGILTRDFSNTGWSETIIEDLLEELYGQMNRLE PIQKEIMQKQNFTMGDTTVLHLRKYYFNLVQYLKSKEYNRCAWTVVQVQILTNFSFLMRL TDYLRD NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgacccaccgttgcctcctcccagtggttctcctgctgtgtttctccaccacagctctt tccaggagctacagcttgcttcaattccaacaaaggcggagccttgcagtgtgtcagaaa ctcctgtggcagttaccttcaactcctcaacattgcctcgaggccaggatggacttccag atgcctgaggagatgaaggaagaacagcagttccagaaggaagatgccatattggtcatc tatgagatgctccagcacatcttcggcattctcaccagagacttctccaacactggctgg tctgagaccatcatcgaggacctccttgaggaactctatgggcagatgaatcgtctggag ccaatccaaaaggaaataatgcagaagcaaaatttcactatgggagacacaaccgttctt cacctgaggaaatattacttcaacctcgtgcagtacctgaagtccaaggagtacaacagg tgtgcctggacagtcgtgcaagtgcaaatactcacgaacttttctttcctgatgagacta acagattacctccgtgactga

Bos mutus (wild yak): 102282466 Help Entry 102282466         CDS       T02919                                  Definition (RefSeq) interferon beta-2   KO K05415   interferon beta Organism bom  Bos mutus (wild yak) Pathway bom04060   Cytokine-cytokine receptor interaction bom04151   PI3K-Akt signaling pathway bom04217   Necroptosis bom04380   Osteoclast differentiation bom04620   Toll-like receptor signaling pathway bom04621   NOD-like receptor signaling pathway bom04622   RIG-I-like receptor signaling pathway bom04623   Cytosolic DNA-sensing pathway bom04630   JAK-STAT signaling pathway bom04650   Natural killer cell mediated cytotoxicity bom04668   TNF signaling pathway bom05135   Yersinia infection bom05142   Chagas disease bom05152   Tuberculosis bom05160   Hepatitis C bom05161   Hepatitis B bom05162   Measles bom05163   Human cytomegalovirus infection bom05164   Influenza A bom05165   Human papillomavirus infection bom05167   Kaposi sarcoma-associated herpesvirus infection bom05168   Herpes simplex virus 1 infection bom05169   Epstein-Barr virus infection bom05170   Human immunodeficiency virus 1 infection bom05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102282466    04668 TNF signaling pathway     102282466    04151 PI3K-Akt signaling pathway     102282466   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102282466  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102282466  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102282466    04621 NOD-like receptor signaling pathway     102282466    04622 RIG-I-like receptor signaling pathway     102282466    04623 Cytosolic DNA-sensing pathway     102282466    04650 Natural killer cell mediated cytotoxicity     102282466   09158 Development and regeneration    04380 Osteoclast differentiation     102282466  09160 Human Diseases   09171 Infectious disease: bacterial    05135 Yersinia infection     102282466    05152 Tuberculosis     102282466   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102282466    05161 Hepatitis B     102282466    05160 Hepatitis C     102282466    05171 Coronavirus disease - COVID-19     102282466    05164 Influenza A     102282466    05162 Measles     102282466    05168 Herpes simplex virus 1 infection     102282466    05163 Human cytomegalovirus infection     102282466    05167 Kaposi sarcoma-associated herpesvirus infection     102282466    05169 Epstein-Barr virus infection     102282466    05165 Human papillomavirus infection     102282466   09174 Infectious disease: parasitic    05142 Chagas disease     102282466  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:bom04052]     102282466 Cytokines and growth factors [BR:bom04052]  Cytokines   Interferons    102282466 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Sigma70_ner Motif Other DBs NCBI-GeneID:  102282466 NCBI-ProteinID:  XP_005898560 UniProt:  L8ID59 LinkDB All DBs Position Un AA seq 187 aa AA seqDB search MTYYRCLLPMVLLLCFSTTALSRSYSLLRFQQRRSAEVCQKLLGQLPSTPQHCLEARMDF QVPEEMNQAQQFRKEDAILVIYEMLQQIFNILTRDFSSTGWSETIIEDLLEELYEQMNRL EPIEKEIMQKQNSTMGDTTVLHLRKYYFNLVQYLKFKEYNRCAWTVVRVQILRNFSFLTR LTGYLHD NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atgacctattaccggtgcctcctcccgatggttctcctgctgtgtttctccaccacagct ctttccaggagctacagcttgctccgattccagcaaaggcggagcgctgaggtgtgtcag aaactcctggggcagttaccttcaacgcctcaacattgcctcgaggccaggatggacttc caggtccctgaggagatgaaccaagcacagcagttccggaaggaagatgccatattggtc atctatgagatgctccagcagatcttcaatattctcaccagagacttctccagcacgggc tggtctgagaccatcattgaggacctccttgaggaactctatgagcaaatgaatcgtttg gagccaatcgagaaggaaataatgcagaagcaaaactccactatgggagacacaaccgtt cttcacctgaggaaatattacttcaacctcgtgcagtacctgaagttcaaggagtacaac aggtgtgcctggacagtcgtacgagtgcaaatactcaggaatttttcttttctgacgaga ctaacaggttacctccatgactga

Bos mutus (wild yak): 102284581 Help Entry 102284581         CDS       T02919                                  Definition (RefSeq) interferon beta-2   KO K05415   interferon beta Organism bom  Bos mutus (wild yak) Pathway bom04060   Cytokine-cytokine receptor interaction bom04151   PI3K-Akt signaling pathway bom04217   Necroptosis bom04380   Osteoclast differentiation bom04620   Toll-like receptor signaling pathway bom04621   NOD-like receptor signaling pathway bom04622   RIG-I-like receptor signaling pathway bom04623   Cytosolic DNA-sensing pathway bom04630   JAK-STAT signaling pathway bom04650   Natural killer cell mediated cytotoxicity bom04668   TNF signaling pathway bom05135   Yersinia infection bom05142   Chagas disease bom05152   Tuberculosis bom05160   Hepatitis C bom05161   Hepatitis B bom05162   Measles bom05163   Human cytomegalovirus infection bom05164   Influenza A bom05165   Human papillomavirus infection bom05167   Kaposi sarcoma-associated herpesvirus infection bom05168   Herpes simplex virus 1 infection bom05169   Epstein-Barr virus infection bom05170   Human immunodeficiency virus 1 infection bom05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102284581    04668 TNF signaling pathway     102284581    04151 PI3K-Akt signaling pathway     102284581   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102284581  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102284581  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102284581    04621 NOD-like receptor signaling pathway     102284581    04622 RIG-I-like receptor signaling pathway     102284581    04623 Cytosolic DNA-sensing pathway     102284581    04650 Natural killer cell mediated cytotoxicity     102284581   09158 Development and regeneration    04380 Osteoclast differentiation     102284581  09160 Human Diseases   09171 Infectious disease: bacterial    05135 Yersinia infection     102284581    05152 Tuberculosis     102284581   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102284581    05161 Hepatitis B     102284581    05160 Hepatitis C     102284581    05171 Coronavirus disease - COVID-19     102284581    05164 Influenza A     102284581    05162 Measles     102284581    05168 Herpes simplex virus 1 infection     102284581    05163 Human cytomegalovirus infection     102284581    05167 Kaposi sarcoma-associated herpesvirus infection     102284581    05169 Epstein-Barr virus infection     102284581    05165 Human papillomavirus infection     102284581   09174 Infectious disease: parasitic    05142 Chagas disease     102284581  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:bom04052]     102284581 Cytokines and growth factors [BR:bom04052]  Cytokines   Interferons    102284581 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  102284581 NCBI-ProteinID:  XP_005910615 UniProt:  L8HQW6 LinkDB All DBs Position Un AA seq 186 aa AA seqDB search MTHRCLLQMVLLLCFSTTALPRSYSLLGLQERRSAAVSQKLLWQLPSTPQRCLEARMDFQ MPEEMKQAQQFQKEDAILVMYEMLQQIFGILTRDFSSTGWSETIIEDLLVELYGQMNRLQ PIQKEIMQKKNFTMGNTTVLHLKKYYLNLMYYLKSKEYNRCAWTVVRVQILTNFSFLKSL TAYLRD NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgacccaccggtgcctcctccagatggttctcctgctgtgtttctccaccacagctctt cccaggagctacagcttgcttggattgcaagaaaggcggagtgctgcggtctctcagaaa ctcctgtggcagttaccttcaactcctcaacgttgcctcgaggccaggatggatttccag atgcctgaggagatgaagcaagcacagcagttccagaaggaagatgccatattggtcatg tatgagatgctccagcagatctttggcattctcaccagagatttctccagcactggctgg tctgagaccatcatcgaggacctccttgtggaactctatgggcagatgaatcgtctgcag ccaatccagaaggaaataatgcagaagaaaaacttcactatgggaaacacaaccgttctt cacctgaagaaatattacctcaacctcatgtactacctgaagtccaaggagtacaacagg tgtgcctggacagtcgtgcgagtgcaaatactcacgaacttttctttcctgaagagccta acagcttacctccgtgactga

DBGET integrated database retrieval system