KEGG   Bos mutus (wild yak): 102280497
Entry
102280497         CDS       T02919                                 

Definition
(RefSeq) interferon beta-2
  KO
K05415  interferon beta
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04217  Necroptosis
bom04380  Osteoclast differentiation
bom04620  Toll-like receptor signaling pathway
bom04621  NOD-like receptor signaling pathway
bom04622  RIG-I-like receptor signaling pathway
bom04623  Cytosolic DNA-sensing pathway
bom04630  JAK-STAT signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom04668  TNF signaling pathway
bom05135  Yersinia infection
bom05142  Chagas disease
bom05152  Tuberculosis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102280497
   04668 TNF signaling pathway
    102280497
   04151 PI3K-Akt signaling pathway
    102280497
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102280497
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102280497
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102280497
   04621 NOD-like receptor signaling pathway
    102280497
   04622 RIG-I-like receptor signaling pathway
    102280497
   04623 Cytosolic DNA-sensing pathway
    102280497
   04650 Natural killer cell mediated cytotoxicity
    102280497
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102280497
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102280497
   05152 Tuberculosis
    102280497
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102280497
   05161 Hepatitis B
    102280497
   05160 Hepatitis C
    102280497
   05171 Coronavirus disease - COVID-19
    102280497
   05164 Influenza A
    102280497
   05162 Measles
    102280497
   05168 Herpes simplex virus 1 infection
    102280497
   05163 Human cytomegalovirus infection
    102280497
   05167 Kaposi sarcoma-associated herpesvirus infection
    102280497
   05169 Epstein-Barr virus infection
    102280497
   05165 Human papillomavirus infection
    102280497
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102280497
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102280497
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interferons
   102280497
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102280497
NCBI-ProteinID: XP_005898555
UniProt: L8IFW6
LinkDB
Position
Un
AA seq 182 aa
MTYRCLLPMVLLLCFSTTALSRSYSLLRFQQRRSLAVLGQLPSTPQHCLEARMDFQVPEE
MNQAQQFRKEDAILVIYEMLQQIFNILTRDFSSTGWSETIIEDLLVELYGQMNRLQPIQK
EIMQKQNSTMGDTTVLHLRKYYFNLVQYLKSKEYNRCAWTVVRVQILRNFSFLTRLTGYL
RD
NT seq 549 nt   +upstreamnt  +downstreamnt
atgacctaccggtgcctcctcccgatggttctcctgctgtgtttctccaccacagctctt
tccaggagctacagcttgcttcgattccaacaaaggcggagccttgcggtactggggcag
ttaccttcaacgcctcaacattgcctcgaggccaggatggacttccaggtccctgaggag
atgaaccaagcacagcagttccggaaggaagatgccatattggtcatctatgagatgctc
cagcagatcttcaatattctcaccagagacttctccagcactggctggtctgagaccatc
attgaggacctccttgtggaactctatgggcagatgaatcgtctgcagccaatccagaag
gaaataatgcagaagcaaaactccactatgggagacacgactgttcttcacctgaggaaa
tattacttcaacctcgtgcagtacctgaagtccaaggagtacaacaggtgtgcctggaca
gtcgtgcgagtgcaaatactcaggaatttttctttcctgacgagactaacaggttacctc
cgtgactga

KEGG   Bos mutus (wild yak): 102281065
Entry
102281065         CDS       T02919                                 

Definition
(RefSeq) interferon beta-2
  KO
K05415  interferon beta
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04217  Necroptosis
bom04380  Osteoclast differentiation
bom04620  Toll-like receptor signaling pathway
bom04621  NOD-like receptor signaling pathway
bom04622  RIG-I-like receptor signaling pathway
bom04623  Cytosolic DNA-sensing pathway
bom04630  JAK-STAT signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom04668  TNF signaling pathway
bom05135  Yersinia infection
bom05142  Chagas disease
bom05152  Tuberculosis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102281065
   04668 TNF signaling pathway
    102281065
   04151 PI3K-Akt signaling pathway
    102281065
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102281065
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102281065
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102281065
   04621 NOD-like receptor signaling pathway
    102281065
   04622 RIG-I-like receptor signaling pathway
    102281065
   04623 Cytosolic DNA-sensing pathway
    102281065
   04650 Natural killer cell mediated cytotoxicity
    102281065
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102281065
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102281065
   05152 Tuberculosis
    102281065
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102281065
   05161 Hepatitis B
    102281065
   05160 Hepatitis C
    102281065
   05171 Coronavirus disease - COVID-19
    102281065
   05164 Influenza A
    102281065
   05162 Measles
    102281065
   05168 Herpes simplex virus 1 infection
    102281065
   05163 Human cytomegalovirus infection
    102281065
   05167 Kaposi sarcoma-associated herpesvirus infection
    102281065
   05169 Epstein-Barr virus infection
    102281065
   05165 Human papillomavirus infection
    102281065
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102281065
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102281065
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interferons
   102281065
SSDB
Motif
Pfam: Interferon DUF2154
Other DBs
NCBI-GeneID: 102281065
NCBI-ProteinID: XP_005898557
UniProt: L8IE01
LinkDB
Position
Un
AA seq 186 aa
MTHRCLLPVVLLLCFSTTALSRSYSLLQFQQRRSLAVCQKLLWQLPSTPQHCLEARMDFQ
MPEEMKEEQQFQKEDAILVIYEMLQHIFGILTRDFSNTGWSETIIEDLLEELYGQMNRLE
PIQKEIMQKQNFTMGDTTVLHLRKYYFNLVQYLKSKEYNRCAWTVVQVQILTNFSFLMRL
TDYLRD
NT seq 561 nt   +upstreamnt  +downstreamnt
atgacccaccgttgcctcctcccagtggttctcctgctgtgtttctccaccacagctctt
tccaggagctacagcttgcttcaattccaacaaaggcggagccttgcagtgtgtcagaaa
ctcctgtggcagttaccttcaactcctcaacattgcctcgaggccaggatggacttccag
atgcctgaggagatgaaggaagaacagcagttccagaaggaagatgccatattggtcatc
tatgagatgctccagcacatcttcggcattctcaccagagacttctccaacactggctgg
tctgagaccatcatcgaggacctccttgaggaactctatgggcagatgaatcgtctggag
ccaatccaaaaggaaataatgcagaagcaaaatttcactatgggagacacaaccgttctt
cacctgaggaaatattacttcaacctcgtgcagtacctgaagtccaaggagtacaacagg
tgtgcctggacagtcgtgcaagtgcaaatactcacgaacttttctttcctgatgagacta
acagattacctccgtgactga

KEGG   Bos mutus (wild yak): 102282466
Entry
102282466         CDS       T02919                                 

Definition
(RefSeq) interferon beta-2
  KO
K05415  interferon beta
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04217  Necroptosis
bom04380  Osteoclast differentiation
bom04620  Toll-like receptor signaling pathway
bom04621  NOD-like receptor signaling pathway
bom04622  RIG-I-like receptor signaling pathway
bom04623  Cytosolic DNA-sensing pathway
bom04630  JAK-STAT signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom04668  TNF signaling pathway
bom05135  Yersinia infection
bom05142  Chagas disease
bom05152  Tuberculosis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102282466
   04668 TNF signaling pathway
    102282466
   04151 PI3K-Akt signaling pathway
    102282466
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102282466
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102282466
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102282466
   04621 NOD-like receptor signaling pathway
    102282466
   04622 RIG-I-like receptor signaling pathway
    102282466
   04623 Cytosolic DNA-sensing pathway
    102282466
   04650 Natural killer cell mediated cytotoxicity
    102282466
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102282466
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102282466
   05152 Tuberculosis
    102282466
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102282466
   05161 Hepatitis B
    102282466
   05160 Hepatitis C
    102282466
   05171 Coronavirus disease - COVID-19
    102282466
   05164 Influenza A
    102282466
   05162 Measles
    102282466
   05168 Herpes simplex virus 1 infection
    102282466
   05163 Human cytomegalovirus infection
    102282466
   05167 Kaposi sarcoma-associated herpesvirus infection
    102282466
   05169 Epstein-Barr virus infection
    102282466
   05165 Human papillomavirus infection
    102282466
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102282466
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102282466
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interferons
   102282466
SSDB
Motif
Pfam: Interferon Sigma70_ner
Other DBs
NCBI-GeneID: 102282466
NCBI-ProteinID: XP_005898560
UniProt: L8ID59
LinkDB
Position
Un
AA seq 187 aa
MTYYRCLLPMVLLLCFSTTALSRSYSLLRFQQRRSAEVCQKLLGQLPSTPQHCLEARMDF
QVPEEMNQAQQFRKEDAILVIYEMLQQIFNILTRDFSSTGWSETIIEDLLEELYEQMNRL
EPIEKEIMQKQNSTMGDTTVLHLRKYYFNLVQYLKFKEYNRCAWTVVRVQILRNFSFLTR
LTGYLHD
NT seq 564 nt   +upstreamnt  +downstreamnt
atgacctattaccggtgcctcctcccgatggttctcctgctgtgtttctccaccacagct
ctttccaggagctacagcttgctccgattccagcaaaggcggagcgctgaggtgtgtcag
aaactcctggggcagttaccttcaacgcctcaacattgcctcgaggccaggatggacttc
caggtccctgaggagatgaaccaagcacagcagttccggaaggaagatgccatattggtc
atctatgagatgctccagcagatcttcaatattctcaccagagacttctccagcacgggc
tggtctgagaccatcattgaggacctccttgaggaactctatgagcaaatgaatcgtttg
gagccaatcgagaaggaaataatgcagaagcaaaactccactatgggagacacaaccgtt
cttcacctgaggaaatattacttcaacctcgtgcagtacctgaagttcaaggagtacaac
aggtgtgcctggacagtcgtacgagtgcaaatactcaggaatttttcttttctgacgaga
ctaacaggttacctccatgactga

KEGG   Bos mutus (wild yak): 102284581
Entry
102284581         CDS       T02919                                 

Definition
(RefSeq) interferon beta-2
  KO
K05415  interferon beta
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04217  Necroptosis
bom04380  Osteoclast differentiation
bom04620  Toll-like receptor signaling pathway
bom04621  NOD-like receptor signaling pathway
bom04622  RIG-I-like receptor signaling pathway
bom04623  Cytosolic DNA-sensing pathway
bom04630  JAK-STAT signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom04668  TNF signaling pathway
bom05135  Yersinia infection
bom05142  Chagas disease
bom05152  Tuberculosis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102284581
   04668 TNF signaling pathway
    102284581
   04151 PI3K-Akt signaling pathway
    102284581
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102284581
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102284581
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102284581
   04621 NOD-like receptor signaling pathway
    102284581
   04622 RIG-I-like receptor signaling pathway
    102284581
   04623 Cytosolic DNA-sensing pathway
    102284581
   04650 Natural killer cell mediated cytotoxicity
    102284581
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102284581
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102284581
   05152 Tuberculosis
    102284581
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102284581
   05161 Hepatitis B
    102284581
   05160 Hepatitis C
    102284581
   05171 Coronavirus disease - COVID-19
    102284581
   05164 Influenza A
    102284581
   05162 Measles
    102284581
   05168 Herpes simplex virus 1 infection
    102284581
   05163 Human cytomegalovirus infection
    102284581
   05167 Kaposi sarcoma-associated herpesvirus infection
    102284581
   05169 Epstein-Barr virus infection
    102284581
   05165 Human papillomavirus infection
    102284581
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102284581
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102284581
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interferons
   102284581
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102284581
NCBI-ProteinID: XP_005910615
UniProt: L8HQW6
LinkDB
Position
Un
AA seq 186 aa
MTHRCLLQMVLLLCFSTTALPRSYSLLGLQERRSAAVSQKLLWQLPSTPQRCLEARMDFQ
MPEEMKQAQQFQKEDAILVMYEMLQQIFGILTRDFSSTGWSETIIEDLLVELYGQMNRLQ
PIQKEIMQKKNFTMGNTTVLHLKKYYLNLMYYLKSKEYNRCAWTVVRVQILTNFSFLKSL
TAYLRD
NT seq 561 nt   +upstreamnt  +downstreamnt
atgacccaccggtgcctcctccagatggttctcctgctgtgtttctccaccacagctctt
cccaggagctacagcttgcttggattgcaagaaaggcggagtgctgcggtctctcagaaa
ctcctgtggcagttaccttcaactcctcaacgttgcctcgaggccaggatggatttccag
atgcctgaggagatgaagcaagcacagcagttccagaaggaagatgccatattggtcatg
tatgagatgctccagcagatctttggcattctcaccagagatttctccagcactggctgg
tctgagaccatcatcgaggacctccttgtggaactctatgggcagatgaatcgtctgcag
ccaatccagaaggaaataatgcagaagaaaaacttcactatgggaaacacaaccgttctt
cacctgaagaaatattacctcaacctcatgtactacctgaagtccaaggagtacaacagg
tgtgcctggacagtcgtgcgagtgcaaatactcacgaacttttctttcctgaagagccta
acagcttacctccgtgactga

DBGET integrated database retrieval system