KEGG   Bos mutus (wild yak): 102280532
Entry
102280532         CDS       T02919                                 

Gene name
IL6ST
Definition
(RefSeq) interleukin 6 signal transducer
  KO
K05060  interleukin 6 signal transducer
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04061  Viral protein interaction with cytokine and cytokine receptor
bom04550  Signaling pathways regulating pluripotency of stem cells
bom04630  JAK-STAT signaling pathway
bom04659  Th17 cell differentiation
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
bom05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102280532 (IL6ST)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102280532 (IL6ST)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102280532 (IL6ST)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102280532 (IL6ST)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102280532 (IL6ST)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102280532 (IL6ST)
   05203 Viral carcinogenesis
    102280532 (IL6ST)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    102280532 (IL6ST)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102280532 (IL6ST)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102280532 (IL6ST)
   04090 CD molecules [BR:bom04090]
    102280532 (IL6ST)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IL6/12 receptor family
   102280532 (IL6ST)
CD molecules [BR:bom04090]
 Proteins
  102280532 (IL6ST)
SSDB
Motif
Pfam: fn3 Lep_receptor_Ig IL6Ra-bind EpoR_lig-bind Pur_ac_phosph_N Interfer-bind fn3_2 ObR_Ig SusE
Other DBs
NCBI-GeneID: 102280532
NCBI-ProteinID: XP_005887446
LinkDB
Position
Un
AA seq 918 aa
MFTLQTWIVQALFIFLTTESIGELLVPCAHIHPESSVVQLGSNFTAVCVLKEKCMDDYHV
TANDIFWKTGRVPVPYEQYSVINRTASSVTFPNITLINALLTCNIRMFGQINRSVYGIRI
ISGLPPEKPKNLSCIVNEGKKMMCQWDPGRETYLETNYTLKSEWATEKFDDCKAKRDTPT
SCTVDYPPVYFVNIEVWVEAENALGKVTSDHINFDPIDKVKLNPPHILSVNSSKELSSIL
KLTWTDSRFKSFITLKYDIQYRTKDASTWNQVPPEDTSSTRSSFTVQDLKPFTEYVFRIR
CMKEDGKGYWSDWSEEASGITYEDRPSKAPNFWYKIEPSHAHGTRSIQLKWKTLPPFEAN
GKILDYEVTLTKWKSHSQNYTVKDTKLTVNLTNDRYVATLTARNLVGKSDASVLTIPAWD
FQATHPITDLKAFPKDNVLWVEWTAPNESVNRYILEWCVLSDKSPCIPDWQQEDGTVHRT
YLRGNLVESKCYLITVTPVYDDGPGSPEHIKAYLKQAAPSRGPTVRTKKVGKNEAVLEWD
HLPIDVQNGFIRNYTIFYRTVIGNEIAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGG
KDGPEFTFTTPKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNKRDLIKKHIWPNVPDPSK
SHIAQWSPHTPPRHFNSKDQMYPDGNFTDVSVVEIEANDKKPFPEDLKSLDLFKKEKVNT
EGHSSGIGGSSCMSSSRPSISSSDENESAQNTSSTVQYSTVVHSGYRHQVPSVQVFSRSE
STQPLLDSEERPEDLQLVDNVDGSDGILPRQRYFKQNCSQHETSPDISHFERSQQVSSVN
EEDFVRLKQQQISDHISQPYGSGKMKMFQEVPAVDAFGPGIEGQVERFETVGMEDAVDEG
MPKSYLPQTVRRGGYMPQ
NT seq 2757 nt   +upstreamnt  +downstreamnt
atgttcacattgcaaacttggatagtgcaagccttgtttattttcctcaccactgaatct
ataggtgaacttctagttccatgtgctcatatccaccctgaatcttcagttgtacaactt
ggttcgaatttcacggcagtttgtgtgctaaaggaaaaatgtatggatgattatcatgtg
actgctaatgacattttctggaaaacaggccgtgtacctgttccttatgaacaatatagt
gtcataaacagaacagcatctagtgtcacatttccaaatataactttaataaatgctctg
ctcacttgcaacattcgtatgtttggacagattaatcggagtgtttatggaatcagaatc
atttcaggcttgcctcctgaaaaacctaaaaatttgagttgcattgtgaatgaaggaaag
aaaatgatgtgtcagtgggatcctggaagggaaacatacctggaaacaaactacacttta
aaatctgagtgggcaacagagaagtttgatgattgtaaagcaaaacgtgacacccccacc
tcatgcactgttgattatcctcctgtgtattttgtcaacattgaagtctgggtagaagca
gagaacgcccttgggaaggttacctcagatcatatcaattttgatcctatagataaagtg
aagctcaatccaccacatattttatcagtcaacagttcaaaggaactgtctagtatttta
aaattgacatggactgattcacgttttaagagttttataacactgaaatatgacattcaa
tataggaccaaagatgcctcaacttggaaccaggttcctcctgaagatacatcatctacc
cgatcttcattcactgttcaggaccttaaaccttttacagaatatgtgtttaggattcgt
tgtatgaaggaagatggtaaaggatattggagtgactggagtgaagaagcaagtggtatc
acgtatgaagatagaccatccaaggcaccaaatttctggtataagatagagccgtctcat
gctcacggcactagatctatacaactcaaatggaagacattgcctccttttgaagctaat
ggaaaaattttggattatgaagtgactctcacaaagtggaaatcacattcacaaaattac
acagttaaagacacaaaactgacagtaaacctcacaaatgatcgctacgtagcaactctg
acagcaagaaatcttgttggcaaatcagacgcgtctgttttaactatccctgcctgggat
tttcaagctactcaccccataactgatcttaaagcatttcccaaagataacgtgctttgg
gtagaatggactgctccaaacgaatctgtaaacagatacatacttgagtggtgtgtgtta
tctgataaatcgccctgtatcccagactggcaacaagaagatggtactgtacatcgcacc
tatttaagaggaaacctagtagagagcaaatgttacttgataacagttactccagtatat
gatgatggaccaggaagccccgagcatataaaggcataccttaaacaagctgcaccttcc
agaggacctactgttcggacaaaaaaagtggggaaaaatgaagctgtcttagagtgggac
caccttcctattgatgttcagaatggatttatcagaaattatactatattttatagaacc
gtcattggaaatgaaatcgctgtgaatgtggattcttcccacacagaatacacactgtcc
tctttgactagtgacactctgtacatggtacgaatggcagcctacacagatgaaggtgga
aaggatggtccagaattcacttttactacaccaaagtttgctcaaggagaaattgaagct
attgttgtacctgtttgcttagcattcctattgacaacccttttgggagttttattctgc
tttaataagcgagacctaattaaaaaacacatctggcctaatgttccagatccttcaaag
agtcatattgcccagtggtcacctcacacacctccaaggcattttaattcaaaagatcaa
atgtatccagatggcaatttcactgatgtaagtgttgtggaaatagaagcaaatgacaaa
aagcctttcccagaggatctaaagtctttggacctattcaagaaagaaaaagttaatact
gaaggacacagtagtggtattggagggtcttcatgcatgtcatcttctaggccaagcatt
tccagcagtgatgaaaatgaatctgcacagaacacttcaagcactgtccaatattccaca
gtggttcacagtggctatagacaccaggtaccatcagtccaagtcttctcaagatctgag
tccacccagcccttgttagattctgaagaacggccagaagatttacagctggtagataat
gtagatggcagtgatggcattctgcccaggcagcggtatttcaagcaaaactgcagtcaa
catgaaaccagtccagatatttcgcattttgaaaggtcacagcaagtttcctcagtcaat
gaagaagattttgttagacttaaacagcagcagatttcagatcatatttcacaaccctat
ggatctgggaaaatgaaaatgtttcaggaagttcctgcagtggatgcttttggtccaggc
attgagggacaagtagagagatttgaaacagttgggatggaggatgcagttgatgaagga
atgcctaaaagttacttaccacagactgtgagacgaggtggctacatgcctcagtga

DBGET integrated database retrieval system