KEGG   Bos mutus (wild yak): 102280554
Entry
102280554         CDS       T02919                                 

Gene name
RHOA
Definition
(RefSeq) ras homolog family member A
  KO
K04513  Ras homolog gene family, member A
Organism
bom  Bos mutus (wild yak)
Pathway
bom04014  Ras signaling pathway
bom04015  Rap1 signaling pathway
bom04022  cGMP-PKG signaling pathway
bom04024  cAMP signaling pathway
bom04062  Chemokine signaling pathway
bom04071  Sphingolipid signaling pathway
bom04072  Phospholipase D signaling pathway
bom04144  Endocytosis
bom04150  mTOR signaling pathway
bom04270  Vascular smooth muscle contraction
bom04310  Wnt signaling pathway
bom04350  TGF-beta signaling pathway
bom04360  Axon guidance
bom04510  Focal adhesion
bom04520  Adherens junction
bom04530  Tight junction
bom04611  Platelet activation
bom04621  NOD-like receptor signaling pathway
bom04625  C-type lectin receptor signaling pathway
bom04660  T cell receptor signaling pathway
bom04670  Leukocyte transendothelial migration
bom04722  Neurotrophin signaling pathway
bom04810  Regulation of actin cytoskeleton
bom04921  Oxytocin signaling pathway
bom04928  Parathyroid hormone synthesis, secretion and action
bom04972  Pancreatic secretion
bom05100  Bacterial invasion of epithelial cells
bom05132  Salmonella infection
bom05133  Pertussis
bom05135  Yersinia infection
bom05152  Tuberculosis
bom05163  Human cytomegalovirus infection
bom05200  Pathways in cancer
bom05203  Viral carcinogenesis
bom05205  Proteoglycans in cancer
bom05206  MicroRNAs in cancer
bom05210  Colorectal cancer
bom05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102280554 (RHOA)
   04015 Rap1 signaling pathway
    102280554 (RHOA)
   04310 Wnt signaling pathway
    102280554 (RHOA)
   04350 TGF-beta signaling pathway
    102280554 (RHOA)
   04072 Phospholipase D signaling pathway
    102280554 (RHOA)
   04071 Sphingolipid signaling pathway
    102280554 (RHOA)
   04024 cAMP signaling pathway
    102280554 (RHOA)
   04022 cGMP-PKG signaling pathway
    102280554 (RHOA)
   04150 mTOR signaling pathway
    102280554 (RHOA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102280554 (RHOA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102280554 (RHOA)
   04520 Adherens junction
    102280554 (RHOA)
   04530 Tight junction
    102280554 (RHOA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102280554 (RHOA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102280554 (RHOA)
   04621 NOD-like receptor signaling pathway
    102280554 (RHOA)
   04625 C-type lectin receptor signaling pathway
    102280554 (RHOA)
   04660 T cell receptor signaling pathway
    102280554 (RHOA)
   04670 Leukocyte transendothelial migration
    102280554 (RHOA)
   04062 Chemokine signaling pathway
    102280554 (RHOA)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102280554 (RHOA)
   04928 Parathyroid hormone synthesis, secretion and action
    102280554 (RHOA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102280554 (RHOA)
  09154 Digestive system
   04972 Pancreatic secretion
    102280554 (RHOA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102280554 (RHOA)
  09158 Development and regeneration
   04360 Axon guidance
    102280554 (RHOA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102280554 (RHOA)
   05206 MicroRNAs in cancer
    102280554 (RHOA)
   05205 Proteoglycans in cancer
    102280554 (RHOA)
   05203 Viral carcinogenesis
    102280554 (RHOA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102280554 (RHOA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102280554 (RHOA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102280554 (RHOA)
   05135 Yersinia infection
    102280554 (RHOA)
   05133 Pertussis
    102280554 (RHOA)
   05152 Tuberculosis
    102280554 (RHOA)
   05100 Bacterial invasion of epithelial cells
    102280554 (RHOA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102280554 (RHOA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bom04131]
    102280554 (RHOA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bom04147]
    102280554 (RHOA)
   04031 GTP-binding proteins [BR:bom04031]
    102280554 (RHOA)
Membrane trafficking [BR:bom04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    102280554 (RHOA)
Exosome [BR:bom04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102280554 (RHOA)
  Exosomal proteins of other body fluids (saliva and urine)
   102280554 (RHOA)
  Exosomal proteins of colorectal cancer cells
   102280554 (RHOA)
  Exosomal proteins of bladder cancer cells
   102280554 (RHOA)
GTP-binding proteins [BR:bom04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    102280554 (RHOA)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 102280554
NCBI-ProteinID: XP_005909438
UniProt: L8HRB3
LinkDB
Position
Un
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgccatccggaagaaactggtgattgttggagatggagcctgtggcaagacttgc
ttgctcattgtctttagcaaggaccagttcccagaggtgtatgtccctacggtgtttgag
aactatgtggcagatattgaagtggatggaaagcaggtagagttggctttatgggacaca
gctgggcaggaagattatgatcgcttgaggcctctctcctacccggataccgacgttata
ctgatgtgtttctccattgatagccctgatagtttagaaaacataccagaaaaatggact
ccggaagtcaagcatttctgtcccaacgtgcccatcatcctggttgggaacaagaaggat
cttcgaaacgacgagcacacaaggcgggagctggccaagatgaagcaggagccagtaaaa
cccgaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgttca
gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagctgctctgcaa
gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system