KEGG   Bos mutus (wild yak): 102281399Help
Entry
102281399         CDS       T02919                                 

Gene name
ITGA2
Definition
(RefSeq) integrin subunit alpha 2
  KO
K06481  integrin alpha 2
Organism
bom  Bos mutus (wild yak)
Pathway
bom04145  Phagosome
bom04151  PI3K-Akt signaling pathway
bom04510  Focal adhesion
bom04512  ECM-receptor interaction
bom04611  Platelet activation
bom04640  Hematopoietic cell lineage
bom04810  Regulation of actin cytoskeleton
bom05165  Human papillomavirus infection
bom05200  Pathways in cancer
bom05205  Proteoglycans in cancer
bom05222  Small cell lung cancer
bom05410  Hypertrophic cardiomyopathy (HCM)
bom05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
bom05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102281399 (ITGA2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102281399 (ITGA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102281399 (ITGA2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102281399 (ITGA2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102281399 (ITGA2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102281399 (ITGA2)
   04611 Platelet activation
    102281399 (ITGA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102281399 (ITGA2)
   05205 Proteoglycans in cancer
    102281399 (ITGA2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102281399 (ITGA2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    102281399 (ITGA2)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    102281399 (ITGA2)
   05414 Dilated cardiomyopathy (DCM)
    102281399 (ITGA2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102281399 (ITGA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bom04147]
    102281399 (ITGA2)
   04515 Cell adhesion molecules [BR:bom04515]
    102281399 (ITGA2)
   04090 CD molecules [BR:bom04090]
    102281399 (ITGA2)
Exosome [BR:bom04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   102281399 (ITGA2)
  Exosomal proteins of bladder cancer cells
   102281399 (ITGA2)
Cell adhesion molecules [BR:bom04515]
 Integrins
  Integrin alpha subunits
   102281399 (ITGA2)
CD molecules [BR:bom04090]
 Proteins
  102281399 (ITGA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 VCBS FG-GAP_2 Integrin_alpha HisK_sensor CHB_HEX_C_1
Motif
Other DBs
NCBI-GeneID: 102281399
NCBI-ProteinID: XP_005891211
LinkDB All DBs
Position
Un
AA seq 1179 aa AA seqDB search
MRPGRTGGTPLQLVLVFSQGILNCCVAYNVGLPKAKIFSGPSSEQFGYAVQQFINPKGNW
LLVGSPWSGFPKNRMGDVYKCPVDLSTTTCEKLNLQTSTSMSNVTEMKTNMSLGLTLTRN
VGTGGFLTCGPLWAQQCGSQYYTTGVCSDVSPDFQLRTSFAPAVQTCPSFIDVVVVCDES
NSIYPWDAVKNFLEKFVQGLDIGPTKTQMGLIQYANNPRVVFNLNTFKSKDEMIKATSQT
FQYGGDLTNTFKAIQYARDTAYSTAAGGRPGATKVMVVVTDGESHDGSKLKAVIDQCNKD
NILRFGIAVLGYLNRNALDTKNLIKEIKAIASIPTERHFFNVSDEADLLEKAGTIGEQIF
SIEGTVQGGDNFQMEMSQVGFSAEYSPQNNILMLGAVGAYDWSGTVVQKTPHGHLIFSKQ
AFEQILQDRNHSSYLGYSVASISTGNSVHFVAGAPRANYTGQIVLYSVNENGNVTVIQSH
RGDQIGSYFGSVLCAVDVNKDTITDVLLVGAPMYMNDLKKEEGRVYLFTITKGILNWHQF
LEGPKGLENARFGSAIAALSDINMDGFNDVIVGSPLENQNSGAVYIYNGHEGMIRLRYSQ
KILGSDRAFSSHLQYFGRSLDGYGDLNGDSITDVSVGAFGQVVQLWSQSIADVSVDASFT
PKKITLLNKNAEIKLKLCFSAKFRPTNQNNQVAIVYNITIDEDQFSSRVMSRGLFKENNE
RCLQKTMIVSQAQRCSEYIIHIQEPSDIISPLNLCMNISLENPGTNPALEAYSETVKVFS
IPFHKDCGDDGVCISDLVLNVQQLPATQQQPFIVSNQNKRLTFSVQLKNKKESAYNTEIV
VDFSENLFFASWSMPVDGTEVTCQIASSQKSVTCNVGYPALKSKQQVTFTINFDFNLQNL
QNQASISFRALSESQEENMADNSVNLKLSLLYDAEIHITRSTNINFYEVSLDGNVSSVVH
SFEDIGPKFIFSIKVTTGSVPVSMASVIIHIPQYTKDKNPLMYLTGVHTDQAGDISCEAE
INPLKIGQTSSSVSFKSENFRHIKELNCRTASCSNITCWLRDLQVKGEYFLNVSTRIWNG
TFAASTFQTVQLTAAAEIDTYNPQIYVIEENTVTIPLTIMKPHEKVEVPTGVIVGSVIAG
ILLLLALVAILWKLGFFKRKYEKMAKNPDETDETTELNS
NT seq 3540 nt NT seq  +upstreamnt  +downstreamnt
atgcggccaggacggacaggcggcacgccgctgcagctggtgttagtgttcagtcaaggc
attttaaactgttgtgtggcatacaacgttggtctcccaaaagcaaagatattttctggt
ccttcaagtgaacagtttggctatgcagtgcagcagtttataaatccaaaaggcaactgg
ttactggttggttcaccatggagtggctttcctaagaaccgaatgggagatgtatataaa
tgtcctgttgatctatccaccactacatgtgaaaaattgaatttgcaaacttccacgagc
atgtccaatgttactgagatgaaaaccaacatgagccttggcttgacactgacaaggaac
gtgggaacaggaggatttcttacctgtggtcccctgtgggcacagcagtgcggaagtcag
tattacacaaccggcgtttgctctgatgtcagtcctgattttcagttgcggaccagcttt
gcgcctgcagttcagacctgcccttccttcatagatgttgtggttgtatgtgatgaatca
aacagtatttatccctgggatgcagtaaagaactttttggaaaaatttgtacaaggccta
gatataggccccacaaagacacagatggggttaattcaatatgccaataatccaagagtt
gtgtttaacctgaatacttttaaatccaaagatgaaatgattaaagccacatcgcagaca
ttccaatatggtggagaccttacaaataccttcaaagcaattcagtatgcaagagatacc
gcttattcaacggctgctggtggacgaccaggtgctacgaaagttatggtggttgtaact
gatggtgaatcccatgatggttcaaagttgaaagctgtgattgatcaatgtaacaaagac
aatatactgaggtttggcatagcagttcttgggtacttaaacagaaacgccctggatact
aaaaatttaataaaggaaattaaagctattgccagtattccaacagaaagacactttttc
aatgtctctgatgaagcagatctactagaaaaggctgggacaataggagaacaaattttc
agcattgaaggtacagttcaaggaggagacaacttccaaatggaaatgtcgcaagtggga
ttcagcgcggaatactctcctcaaaataatattctgatgctgggtgcagtaggagcttac
gactggagtgggactgtggtgcagaagacacctcatggacatttgatcttttctaaacaa
gcgtttgaacaaattctgcaagacagaaatcacagctcatatttaggttactctgtggct
tcaatttctactgggaacagtgtccactttgttgctggtgctcctcgagcaaattatact
ggccagatagtgctctacagtgttaatgagaatggcaatgtcacagttattcagtctcac
agaggtgaccagattggctcctattttggtagtgtgctgtgtgcagtcgatgtgaataag
gacaccattacagatgtgctcttggtaggtgcgccaatgtacatgaatgacctaaagaaa
gaggaaggaagagtctacctgtttactattacaaagggcattttgaattggcaccaattt
ctggaaggccccaagggtcttgaaaatgctcgatttggttcagcaattgcagctctttca
gacatcaacatggatggctttaatgacgtgattgttggttcgcctttggaaaatcagaac
tctggagctgtgtacatctacaatggtcatgagggcatgattcgcttgaggtattctcag
aaaatcctggggtccgacagagcctttagtagccacctccagtactttgggagatccctg
gatggctatggagatttaaatggggattccatcaccgacgtgtccgtgggggcctttgga
caggtcgttcagctctggtcacagagcattgctgatgtatctgtagatgcttcattcaca
ccaaaaaaaatcactttgctcaacaaaaatgctgagataaaacttaaactctgcttcagt
gctaagtttagacctactaatcaaaacaatcaagtggccattgtgtataacatcacaatt
gatgaagaccagttttcatccagagtgatgtccagggggttatttaaggaaaataatgaa
aggtgcttgcagaagaccatgatagtaagtcaagcacagcgctgttctgagtacatcatc
cacatacaggagccctctgacattatcagccctctgaatctgtgtatgaacattagtctg
gaaaaccctggcactaaccctgcccttgaagcctactctgagacggtcaaggtcttcagt
atccctttccataaagactgtggtgatgatggagtttgcatttctgatctagttctaaat
gttcagcagctgccagccactcaacaacagcccttcattgtcagcaaccaaaacaaaagg
ttaacattttcagtacaactgaaaaacaagaaggaaagtgcctacaacactgagattgtt
gttgatttttcagaaaacctgttttttgcttcctggtccatgccggttgatgggacagaa
gtgacctgccagattgcttcatctcagaagtctgttacctgcaatgtgggctaccctgct
ttaaagagcaaacaacaggtgactttcactattaacttcgacttcaatcttcaaaacctt
cagaatcaggcatctatcagtttccgagccttaagcgaaagccaggaagaaaacatggca
gataattcagtcaacttaaaactctctctgctgtatgatgccgaaattcacataacaaga
tctaccaacataaatttttatgaagtctccttggatgggaatgtttcttctgtcgtgcac
agttttgaagatattggtccaaaattcatcttctccattaaggtaacaacaggaagtgtt
ccagtaagcatggcatctgtgatcatccacatccctcaatacaccaaagacaagaacccg
ctgatgtacctgaccggggtgcacacagatcaggctggtgacatcagttgcgaagccgaa
ataaatccactgaaaataggacagacgtcttcttctgtatctttcaagagtgaaaatttc
cggcacataaaagaattgaactgtagaaccgcttcatgcagtaacatcacgtgctggctg
agagaccttcaggtgaaaggagaatacttccttaatgtgtccacgaggatttggaatggg
actttcgcagcatcgactttccagacagtacagttgacagcagctgcagaaattgacacg
tacaaccctcagatatacgtgatcgaagaaaacacggtgacgattccccttacgataatg
aaaccccatgagaaagttgaagtaccgactggagtgatagtaggaagtgtaatcgctgga
atccttttgctattagctctagttgcaattttatggaagcttggattcttcaaaagaaaa
tatgaaaaaatggccaaaaatccagatgaaactgatgagaccacagaactcaacagctga

DBGET integrated database retrieval system