KEGG   Bos mutus (wild yak): 102281443
Entry
102281443         CDS       T02919                                 

Gene name
IKBKB
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit beta
  KO
K07209  inhibitor of nuclear factor kappa-B kinase subunit beta [EC:2.7.11.10]
Organism
bom  Bos mutus (wild yak)
Pathway
bom01523  Antifolate resistance
bom04010  MAPK signaling pathway
bom04014  Ras signaling pathway
bom04062  Chemokine signaling pathway
bom04064  NF-kappa B signaling pathway
bom04068  FoxO signaling pathway
bom04150  mTOR signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04210  Apoptosis
bom04380  Osteoclast differentiation
bom04620  Toll-like receptor signaling pathway
bom04621  NOD-like receptor signaling pathway
bom04622  RIG-I-like receptor signaling pathway
bom04623  Cytosolic DNA-sensing pathway
bom04625  C-type lectin receptor signaling pathway
bom04657  IL-17 signaling pathway
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom04660  T cell receptor signaling pathway
bom04662  B cell receptor signaling pathway
bom04668  TNF signaling pathway
bom04722  Neurotrophin signaling pathway
bom04910  Insulin signaling pathway
bom04920  Adipocytokine signaling pathway
bom04930  Type II diabetes mellitus
bom04931  Insulin resistance
bom04932  Non-alcoholic fatty liver disease
bom05010  Alzheimer disease
bom05132  Salmonella infection
bom05135  Yersinia infection
bom05142  Chagas disease
bom05145  Toxoplasmosis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
bom05206  MicroRNAs in cancer
bom05212  Pancreatic cancer
bom05215  Prostate cancer
bom05220  Chronic myeloid leukemia
bom05221  Acute myeloid leukemia
bom05222  Small cell lung cancer
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bom05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102281443 (IKBKB)
   04014 Ras signaling pathway
    102281443 (IKBKB)
   04064 NF-kappa B signaling pathway
    102281443 (IKBKB)
   04668 TNF signaling pathway
    102281443 (IKBKB)
   04068 FoxO signaling pathway
    102281443 (IKBKB)
   04151 PI3K-Akt signaling pathway
    102281443 (IKBKB)
   04150 mTOR signaling pathway
    102281443 (IKBKB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102281443 (IKBKB)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102281443 (IKBKB)
   04621 NOD-like receptor signaling pathway
    102281443 (IKBKB)
   04622 RIG-I-like receptor signaling pathway
    102281443 (IKBKB)
   04623 Cytosolic DNA-sensing pathway
    102281443 (IKBKB)
   04625 C-type lectin receptor signaling pathway
    102281443 (IKBKB)
   04660 T cell receptor signaling pathway
    102281443 (IKBKB)
   04658 Th1 and Th2 cell differentiation
    102281443 (IKBKB)
   04659 Th17 cell differentiation
    102281443 (IKBKB)
   04657 IL-17 signaling pathway
    102281443 (IKBKB)
   04662 B cell receptor signaling pathway
    102281443 (IKBKB)
   04062 Chemokine signaling pathway
    102281443 (IKBKB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102281443 (IKBKB)
   04920 Adipocytokine signaling pathway
    102281443 (IKBKB)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102281443 (IKBKB)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102281443 (IKBKB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102281443 (IKBKB)
   05206 MicroRNAs in cancer
    102281443 (IKBKB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102281443 (IKBKB)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102281443 (IKBKB)
   05221 Acute myeloid leukemia
    102281443 (IKBKB)
   05220 Chronic myeloid leukemia
    102281443 (IKBKB)
   05215 Prostate cancer
    102281443 (IKBKB)
   05222 Small cell lung cancer
    102281443 (IKBKB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102281443 (IKBKB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102281443 (IKBKB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102281443 (IKBKB)
   04932 Non-alcoholic fatty liver disease
    102281443 (IKBKB)
   04931 Insulin resistance
    102281443 (IKBKB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102281443 (IKBKB)
   05135 Yersinia infection
    102281443 (IKBKB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102281443 (IKBKB)
   05170 Human immunodeficiency virus 1 infection
    102281443 (IKBKB)
   05161 Hepatitis B
    102281443 (IKBKB)
   05160 Hepatitis C
    102281443 (IKBKB)
   05171 Coronavirus disease - COVID-19
    102281443 (IKBKB)
   05164 Influenza A
    102281443 (IKBKB)
   05162 Measles
    102281443 (IKBKB)
   05168 Herpes simplex virus 1 infection
    102281443 (IKBKB)
   05163 Human cytomegalovirus infection
    102281443 (IKBKB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102281443 (IKBKB)
   05169 Epstein-Barr virus infection
    102281443 (IKBKB)
   05165 Human papillomavirus infection
    102281443 (IKBKB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102281443 (IKBKB)
   05142 Chagas disease
    102281443 (IKBKB)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    102281443 (IKBKB)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     102281443 (IKBKB)
Protein kinases [BR:bom01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   102281443 (IKBKB)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo APH ubiquitin YrbL-PhoP_reg Med20 GTSE1_N Glyco_hydro_65m
Other DBs
NCBI-GeneID: 102281443
NCBI-ProteinID: XP_005901827
UniProt: L8I6C2
LinkDB
Position
Un
AA seq 756 aa
MSWSPSLPTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCL
EIQIMRRLNHPNVVAARDVPEGMQSLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG
AILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCT
SFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSE
MDIVVSEDLNGAVKFSSSLPHPNNLNSVLAQRLEKWLQLMLMWHPRQRGTDPVYGPNGCF
KALDDILNLKLLHVLNMVTGTLHTYPVTEDESLQSLKARIRQDTGILEEDQELLQEAGLA
LIPDKPAAQCLSDGKLNEGRTLDMDLVFLFDNSRVTYESQVSPQPQPESVSCILQEPKRN
LPFFQLRKVWGQVWHSIQALKEDCSRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLK
AKLDFFKTSIQIDLEKYREQTEFGITSDKLLLAWREMEQAVELCGRENEVKHLVERMMAL
QTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTDGDSQEMVRLLLQAIQG
FEKKVRVIYTQLSKTVVCKQKALELLPKVEEVVSLMSEDEKMVVRLQEKRQKELWNLLKI
ACSKVRGPVSGSPDSMNASRLSHPCQLMSQPCTAPDSLPEAAEKSEDLVAEAHTLCTQLE
NALQDTMKEQDQSLRSLDWSWLQSEEEEQQSLERAS
NT seq 2271 nt   +upstreamnt  +downstreamnt
atgagctggtcaccttccctgccaacccagacatgtggggcctgggaaatgaaagagcgt
cttgggacagggggatttgggaacgtcatccgatggcacaatcaggagacgggcgagcag
attgccatcaagcagtgccggcaagagctcagtccccggaaccgcgagcgctggtgcctg
gagatccagatcatgaggaggctgaaccaccccaatgtggtggccgcccgggacgtccct
gaaggcatgcagagcctggctcccaacgacctgcccctgctggccatggagtactgccag
ggcggggacctgcgcaagtacctgaaccagtttgagaactgctgcggcctgcgggaagga
gccatcctcaccttgctgagcgacattgcctctgcacttcgataccttcatgagaacaga
atcatccatcgggatctgaagccagaaaacattgtcctgcagcaaggggagcagagatta
atacacaaaattattgacctgggatatgccaaggagctggaccagggcagcctctgcacg
tccttcgtggggaccctgcagtacctggcccccgagctgctggagcagcagaagtacacg
gtgaccgtggactactggagcttcggcaccttggccttcgagtgcatcaccggcttccgg
cctttcctgcccaactggcagccggtgcagtggcactccaaagtccggcagaagagcgag
atggacatcgtggtgagcgaggacctgaacggggccgtgaagttctccagctcgctgccg
caccccaacaacctcaacagcgtcctggcccagcggctggagaagtggctgcagctgatg
ctgatgtggcacccgcgccagaggggcaccgaccctgtctacgggcccaacggctgcttc
aaggccctggacgacatcttgaacttgaagctgcttcatgtcctgaacatggtcacgggc
accctgcacacctaccccgtgaccgaggacgagagcctgcagagcctgaaggcccgcatc
cgccaggacacaggcatcctcgaggaggaccaggagctgctgcaggaggcagggctggcc
ctgatccccgacaagcctgccgcccagtgcctctcggacggcaagctgaacgagggccgc
acgctggacatggacctcgttttcctctttgacaacagcagggtcacctatgaaagccag
gtctccccacagccccagcctgaaagcgtcagctgcatcttgcaagagcccaagaggaac
ctcccgttcttccagctgcggaaggtgtggggccaagtctggcacagcatccaggccctg
aaggaagactgcagccgcctgcagcagggccagcgcgcggccatgatgaatctgctgcgg
aacaacagctgtctgtccaagatgaagaactccatggcctccatgtctcagcagctcaag
gccaagctggacttctttaagaccagtatccagattgacctggagaagtacagggagcag
acggagtttgggatcacgtcagacaagctgctgctagcctggagggagatggagcaggcc
gtggagctctgcggacgggagaacgaggtgaagcacttggtggagcggatgatggccctg
cagacggacatcgtggacctgcagcgcagccccatgggccggaagcagggcgggacgctg
gatgatctggaagagcaggcgcgggagctttaccgcaggctgagggagaagcccagagac
cagcggactgatggtgacagtcaggaaatggtgcggctgctcctccaggcaatccaaggc
tttgagaagaaagtgcgagtgatttatacgcagctcagtaagaccgtggtctgcaagcag
aaggccctggagctgctgcccaaggtggaggaggtggtcagcctgatgagcgaggacgag
aagatggtggtgcggctgcaggagaagcggcagaaggagctctggaacctcctgaagatt
gcgtgtagcaaggtccggggtcccgtcagcggaagcccggacagtatgaacgcctcccgc
ctgagtcacccctgccagctgatgtcacagccctgcacggctcccgacagcttgcccgag
gccgccgagaagagtgaggacctggtggctgaagctcacaccctgtgcacccagctggag
aacgccctgcaggacaccatgaaggagcaggaccagagtttgaggtctctagactggagc
tggttgcagtcggaggaggaggaacagcagagcctggagcgggcctcgtga

DBGET integrated database retrieval system