KEGG   Bos mutus (wild yak): 102281444
Entry
102281444         CDS       T02919                                 

Gene name
EIF2AK2
Definition
(RefSeq) eukaryotic translation initiation factor 2 alpha kinase 2
  KO
K16195  eukaryotic translation initiation factor 2-alpha kinase 2 [EC:2.7.11.1]
Organism
bom  Bos mutus (wild yak)
Pathway
bom04141  Protein processing in endoplasmic reticulum
bom04217  Necroptosis
bom05010  Alzheimer disease
bom05160  Hepatitis C
bom05162  Measles
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05171  Coronavirus disease - COVID-19
bom05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102281444 (EIF2AK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102281444 (EIF2AK2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102281444 (EIF2AK2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102281444 (EIF2AK2)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102281444 (EIF2AK2)
   05171 Coronavirus disease - COVID-19
    102281444 (EIF2AK2)
   05164 Influenza A
    102281444 (EIF2AK2)
   05162 Measles
    102281444 (EIF2AK2)
   05168 Herpes simplex virus 1 infection
    102281444 (EIF2AK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102281444 (EIF2AK2)
   05169 Epstein-Barr virus infection
    102281444 (EIF2AK2)
   05165 Human papillomavirus infection
    102281444 (EIF2AK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bom01001]
    102281444 (EIF2AK2)
   01009 Protein phosphatases and associated proteins [BR:bom01009]
    102281444 (EIF2AK2)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bom03019]
    102281444 (EIF2AK2)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102281444 (EIF2AK2)
Protein kinases [BR:bom01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   102281444 (EIF2AK2)
Protein phosphatases and associated proteins [BR:bom01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102281444 (EIF2AK2)
Messenger RNA biogenesis [BR:bom03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     102281444 (EIF2AK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr dsrm Kdo DND1_DSRM ABC1 Kinase-like
Other DBs
NCBI-GeneID: 102281444
NCBI-ProteinID: XP_005901968
UniProt: L8I613
LinkDB
Position
Un
AA seq 533 aa
MATGRSPCFYIEELNKYQQKNCVEVRYCELAKTGPPHNFRFTYQVIIDDKEYPQTEGRSK
KEAKNAAAKLALEIINKDRKSVSFSSQLTTNIPEGPPIENYIGRLNTISQKKNLCVTYEE
CKSKGDGPEGFHYICKIGQEEYGSGVGSTKQEAKQLAAKLAYEKIESETMRDCFSAACGD
VERNSPAVSTSSSESPSENGFSTNASERSDNNSGTLNSSSVSPGDGSRNNSRKVKRSLAP
TFVSPVKTEGNIYSVNERLVNDFTEVTPIGSGGFGQVFKAKHKIDKKTYVIKCVKYNSEK
VEREVKALATLNHPNIVHYHSCWDGHDYDPEQSLNSSRSKTRCLFIQMEYCDKGTLDQWI
EKRRGKKPDKRLALDFFQQITTGVHYIHSEQLIHRDLKPGNIFLVAMNQIKIGDFGLVTY
LKNDETRTSKKGTLRYMSPEQLSSVKDYGNEVDIYALGLILAELLHICPTSLETQKFFDD
LRNGRLDVFDDKEKDLLEKLLSVDPKKRPTASEILKTLKEWNNVTEKKKRNTC
NT seq 1602 nt   +upstreamnt  +downstreamnt
atggccactggtcgttcaccatgtttctacatagaagaacttaataaataccaacaaaag
aactgtgtagaagttaggtattgtgaactggctaagacaggacctccacataattttagg
tttacatatcaagttataatagatgataaagaatatccacagactgaaggtagatcaaag
aaggaagccaaaaacgctgcagccaaattagctttggaaataattaataaagaccgtaag
tcagttagtttttcatctcagctgacaacaaatattccagaaggaccacccattgagaat
tacataggccgtcttaatacgatctcccagaagaaaaacctatgtgtaacttatgaagaa
tgtaaatcaaagggtgatgggcccgaaggatttcattatatatgcaaaattggacaagaa
gaatatggtagtggtgtgggttccactaaacaggaggcaaaacagttggctgccaaactg
gcttatgaaaagatagaatcagaaacaatgagagattgtttcagtgctgcgtgtggtgat
gtcgaaagaaactctccagcagtgagtacatctagttctgaatcaccgtctgaaaatggc
ttctcaacaaatgcatcagaaagaagtgataacaacagtggcacattaaacagctcttcc
gtgtctccaggggacggttccagaaataattccaggaaggtgaagagaagtttggcgcct
acatttgtctctcctgtgaagacagaaggaaacatttatagtgtgaacgaaaggttggtc
aacgatttcacagaagtaacaccaattggctcaggtggatttggccaagttttcaaagcc
aaacacaaaattgataagaagacttatgttattaaatgtgttaaatataatagtgagaag
gtggagcgtgaagtgaaagctttggcaacacttaatcatccaaatattgttcattaccac
agttgttgggatgggcatgattatgatcctgagcaaagcttaaattcttcaagatcaaag
actaggtgccttttcatccagatggaatattgtgataaaggtacgttggaccaatggatt
gagaaaagaagaggcaagaagccagacaaacgtttggctttggatttctttcaacaaata
acaacaggagtgcattatatacattcagaacagttaattcatagagaccttaagccaggt
aacatatttttagtagctatgaaccaaatcaagattggagactttggacttgttacatac
ctgaaaaatgatgaaacgcggacaagtaaaaagggaactttacgatacatgagcccagaa
cagctttcttctgtgaaagactatggaaatgaagtggacatctatgctttggggctgatt
cttgcagaacttcttcatatatgtcccacttctttagaaacacagaagttctttgacgat
ctaaggaatggcagattagatgtatttgacgacaaagaaaaagatcttctggagaaatta
ctctcagtggaccccaagaaacgacctaccgcatctgagatactgaagactttgaaggag
tggaataatgttacagaaaaaaagaaacgaaacacatgttag

DBGET integrated database retrieval system