KEGG   Bos mutus (wild yak): 102281612
Entry
102281612         CDS       T02919                                 

Gene name
PTPN2
Definition
(RefSeq) protein tyrosine phosphatase, non-receptor type 2
  KO
K18026  tyrosine-protein phosphatase non-receptor type 2 [EC:3.1.3.48]
Organism
bom  Bos mutus (wild yak)
Pathway
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102281612 (PTPN2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bom01009]
    102281612 (PTPN2)
Enzymes [BR:bom01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     102281612 (PTPN2)
Protein phosphatases and associated proteins [BR:bom01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    102281612 (PTPN2)
SSDB
Motif
Pfam: Y_phosphatase DSPc
Other DBs
NCBI-GeneID: 102281612
NCBI-ProteinID: XP_005892422
LinkDB
Position
Un
AA seq 289 aa
MVWQQKTKAVVMLNRIVEKDSVKCAQYWPTKDDREMLFKETGFSVKFLSEDVKSYYTVHL
LQLGNTRTGETRTISHFHYTTWPDFGVPESPASFLNFLFKVRESGSLNPEHGPAVIHCSA
GIGRSGTFSLVDSCLVLIEKGDNINIKQLLLNMRKYRMGLIQTPDQLRFSYMTIIEGAKF
IKGDSSIQKRWKELSKEDVCPVFDHSPTKIMTEKYNGNRIGLEEEKLTGDRYSGLSSKTQ
EAPEESSESALRKRLREDRKASTAQKVQQMKQRLSETERKRKRPRLTDT
NT seq 870 nt   +upstreamnt  +downstreamnt
atggtttggcagcaaaagaccaaagcagttgtcatgctaaaccgaattgtggagaaagac
tcggttaaatgtgcacagtactggcctacaaaagatgaccgggagatgctgtttaaggaa
acgggcttcagcgtgaagttcctgtcagaggacgtgaagtcctattacacagtccatctg
ttgcagttaggaaacaccaggactggtgaaaccagaacaatatctcactttcattatact
acctggccagattttggagtccctgaatcaccagcttcgtttctcaatttcttattcaaa
gtgcgggaatctggctccttgaaccctgagcacgggcctgcggtgatccactgcagtgcc
ggcattgggcggtcaggcaccttttcgctggtggacagctgccttgttctgatagaaaaa
ggagacaatattaacattaaacaactgttactgaatatgagaaaataccgaatggggctg
attcagacaccagatcagctcagattttcctacatgactataatagaaggagcgaagttt
ataaagggagactcaagtatacagaaacgttggaaagaactttctaaggaagatgtatgt
cctgtttttgatcattcgccaaccaaaataatgactgaaaaatacaatgggaacaggata
ggcctagaagaggaaaaactgacaggagacagatactcaggtctgtcctctaaaacacag
gaagctccggaggagagcagcgagagtgctctgcgcaagcgcctccgggaggacaggaag
gccagcaccgcccagaaggtgcagcagatgaagcagaggctgagcgagactgagcgcaag
aggaaaaggccaagattgacagacacctaa

DBGET integrated database retrieval system