KEGG   Bos mutus (wild yak): 102281727
Entry
102281727         CDS       T02919                                 

Gene name
MTOR
Definition
(RefSeq) mechanistic target of rapamycin
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
bom  Bos mutus (wild yak)
Pathway
bom01521  EGFR tyrosine kinase inhibitor resistance
bom01522  Endocrine resistance
bom04012  ErbB signaling pathway
bom04066  HIF-1 signaling pathway
bom04072  Phospholipase D signaling pathway
bom04136  Autophagy - other
bom04140  Autophagy - animal
bom04150  mTOR signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04152  AMPK signaling pathway
bom04211  Longevity regulating pathway
bom04213  Longevity regulating pathway - multiple species
bom04218  Cellular senescence
bom04371  Apelin signaling pathway
bom04630  JAK-STAT signaling pathway
bom04659  Th17 cell differentiation
bom04714  Thermogenesis
bom04910  Insulin signaling pathway
bom04919  Thyroid hormone signaling pathway
bom04920  Adipocytokine signaling pathway
bom04930  Type II diabetes mellitus
bom04931  Insulin resistance
bom04935  Growth hormone synthesis, secretion and action
bom05010  Alzheimer disease
bom05014  Amyotrophic lateral sclerosis
bom05016  Huntington disease
bom05017  Spinocerebellar ataxia
bom05022  Pathways of neurodegeneration - multiple diseases
bom05163  Human cytomegalovirus infection
bom05165  Human papillomavirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05170  Human immunodeficiency virus 1 infection
bom05200  Pathways in cancer
bom05205  Proteoglycans in cancer
bom05206  MicroRNAs in cancer
bom05210  Colorectal cancer
bom05212  Pancreatic cancer
bom05214  Glioma
bom05215  Prostate cancer
bom05221  Acute myeloid leukemia
bom05224  Breast cancer
bom05225  Hepatocellular carcinoma
bom05226  Gastric cancer
bom05230  Central carbon metabolism in cancer
bom05231  Choline metabolism in cancer
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102281727 (MTOR)
   04371 Apelin signaling pathway
    102281727 (MTOR)
   04630 JAK-STAT signaling pathway
    102281727 (MTOR)
   04066 HIF-1 signaling pathway
    102281727 (MTOR)
   04072 Phospholipase D signaling pathway
    102281727 (MTOR)
   04151 PI3K-Akt signaling pathway
    102281727 (MTOR)
   04152 AMPK signaling pathway
    102281727 (MTOR)
   04150 mTOR signaling pathway
    102281727 (MTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102281727 (MTOR)
   04136 Autophagy - other
    102281727 (MTOR)
  09143 Cell growth and death
   04218 Cellular senescence
    102281727 (MTOR)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102281727 (MTOR)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102281727 (MTOR)
   04920 Adipocytokine signaling pathway
    102281727 (MTOR)
   04935 Growth hormone synthesis, secretion and action
    102281727 (MTOR)
   04919 Thyroid hormone signaling pathway
    102281727 (MTOR)
  09149 Aging
   04211 Longevity regulating pathway
    102281727 (MTOR)
   04213 Longevity regulating pathway - multiple species
    102281727 (MTOR)
  09159 Environmental adaptation
   04714 Thermogenesis
    102281727 (MTOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102281727 (MTOR)
   05206 MicroRNAs in cancer
    102281727 (MTOR)
   05205 Proteoglycans in cancer
    102281727 (MTOR)
   05230 Central carbon metabolism in cancer
    102281727 (MTOR)
   05231 Choline metabolism in cancer
    102281727 (MTOR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102281727 (MTOR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102281727 (MTOR)
   05212 Pancreatic cancer
    102281727 (MTOR)
   05225 Hepatocellular carcinoma
    102281727 (MTOR)
   05226 Gastric cancer
    102281727 (MTOR)
   05214 Glioma
    102281727 (MTOR)
   05221 Acute myeloid leukemia
    102281727 (MTOR)
   05215 Prostate cancer
    102281727 (MTOR)
   05224 Breast cancer
    102281727 (MTOR)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102281727 (MTOR)
   05014 Amyotrophic lateral sclerosis
    102281727 (MTOR)
   05016 Huntington disease
    102281727 (MTOR)
   05017 Spinocerebellar ataxia
    102281727 (MTOR)
   05022 Pathways of neurodegeneration - multiple diseases
    102281727 (MTOR)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102281727 (MTOR)
   04931 Insulin resistance
    102281727 (MTOR)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102281727 (MTOR)
   05168 Herpes simplex virus 1 infection
    102281727 (MTOR)
   05163 Human cytomegalovirus infection
    102281727 (MTOR)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102281727 (MTOR)
   05165 Human papillomavirus infection
    102281727 (MTOR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102281727 (MTOR)
   01522 Endocrine resistance
    102281727 (MTOR)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102281727 (MTOR)
Protein kinases [BR:bom01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   102281727 (MTOR)
Membrane trafficking [BR:bom04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    102281727 (MTOR)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 UME V-ATPase_H_N EPSP_synthase HEAT_EZ
Other DBs
NCBI-GeneID: 102281727
NCBI-ProteinID: XP_005901367
LinkDB
Position
Un
AA seq 2548 aa
MLGTGPAAATTAATTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQSVQPQQSNALVGLLGYSSHQGLMGFGASPSPAKSMLVESR
CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSVHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSSGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEAPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSSQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITNAATAATTAATATATTTSTEGSNSESEAESAENS
PTPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDV
NEALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVA
SKSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYF
GERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQ
AWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPS
LQVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKN
LSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLT
LMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDR
HPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRIT
CHTVMEVLREHKDSVMAVLEAFVXLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDGV
ELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDETLDV
PTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7647 nt   +upstreamnt  +downstreamnt
atgcttggaaccggccctgctgctgccaccacagctgccaccacgtccagcaatgtgagc
gtcctgcagcagtttgccagcggcctgaagagccggaatgaagagactagggccaaagct
gccaaggagctccagcactacgtcaccatggagctccgagagatgagtcaagaggagtct
actcgcttctatgatcagctgaaccatcacatctttgaactggtgtccagctcagatgcc
aatgagaggaaaggtggcattttggccatagccagcctcataggagtggaaggcgggaat
gccactcgaattggaagatttgctaactaccttcggaacctccttccctccaacgaccca
gttgtcatggaaatggcatccaaggccatcggtcggctcgccatggcaggggacactttc
actgctgagtatgtggagtttgaggtgaagcgagccctggaatggctgggtgctgaccgc
aatgagggccggagacacgcggctgtcctggtgctccgtgagctggccatcagcgtcccc
accttcttcttccagcaagtgcagcccttctttgataatatttttgtggccgtgtgggac
cccaaacaggccatccgggaaggagctgtcgccgcccttcgtgcctgtctgatcctcacc
acccagcgggagccaaaagagatgcagaagccgcagtggtacaggcacacatttgaagaa
gcagagaaagggtttgatgagaccttggccaaggagaagggcatgaatcgggatgaccgg
atccatggagccctgcttatcctcaatgagctggtccggatcagtagcatggagggagag
cgcctgagagaagaaatggaagaaatcacacagcagcagttggtccatgacaagtactgc
aaggatctcatgggttttggaacgaagccccgtcacatcacccccttcaccagtttccag
tccgtgcagccccagcagtcaaatgccttggtggggctgctggggtacagctctcaccaa
ggcctcatgggctttggggcctcccccagcccagcaaagtccatgctggtggaaagtcgc
tgctgcagggacttgatggaggagaaatttgatcaggtgtgccagtgggtgctgaagtgc
aggaatagcaagaactcgctgatccaaatgacaatccttaatttgttgccccgcttggct
gccttccgaccttctgccttcacagatacccagtacctccaggataccatgaaccatgtc
ctgagctgcgtcaagaaggagaaggaacggacagcagcctttcaagccctggggctactt
tctgtggctgtgaggtctgagttcaaggtctatttacctcgtgtgctggacatcatccga
gcagccctgccccctaaggacttcgcccataagagacagaaggctatgcaggtggatgcc
acagtgttcacctgcatcagcatgctggcccgagccatggggccaggcatccaacaggac
atcaaggagctgctggagcccatgctggcggtgggcctgagccctgccctcacagctgtg
ctctacgacctgagccgtcagattccacagctgaaaaaggacatccaagacgggctcctg
aagatgctgtccctggtccttatgcacaaacccctccggcaccccggcatgcccaagggc
ctggcccatcagctggcttcccctggtctcacgaccctccctgaggccagtgatgtgggc
agcatcacccttgctctccgaactctcggcagttttgaatttgaaggccactctctgacc
cagtttgtccgccactgtgcggatcacttcctgaacagcgagcacaaggagatccgtatg
gaggccgcccgcacctgctcccgcctgctcacaccctctgtccacctcatcagtggccac
gctcatgtggtcagccagactgcagtgcaagtggtggcagatgtgctcagcaaactgctc
gtggttgggataaccgatcctgaccctgacatccgctactgtgtcttggcgtccctggac
gagcgctttgatgcacacctggcccaggcggagaacctgcaggccctgttcgtggctctg
aatgaccaggtgtttgagatccgggagctggccatctgcactgtgggccggctcagcagc
atgaacccagccttcgtcatgcccttcctacgcaagatgctcatccagattctcacagag
ctggagcacagcggcattggaagaatcaaggagcagagtgcccgcatgctgggccacctg
gtctccaacgccccgcggctcatccgcccctacatggagcctattctgaaggctttaatt
ttgaaactgaaagatccagaccctgatccaaacccaggtgtgatcaataatgtcttggct
acgataggagagttggctcaggttagtggccttgaaatgaggaaatgggttgatgaactt
tttattatcattatggacatgctccaagactcctctctgttggccaaaaggcaggtggct
ctgtggaccttggggcagttggtggccagcactggctacgtggtagagccctacaggaag
taccccacattgctggaggtgctgctgaactttctgaagactgagcaaaaccagggtaca
cggcgggaggctatccgtgtgttggggctcctaggggcattggatccctacaagcacaaa
gtgaacattggcatgatcgaccagtcccgggacgcttctgccgtcagcctgtcagagtcc
aagtcaagtcaggattcttctgactacagcaccagcgagatgctggtcaacatggggaac
ctgcctctagacgagttctacccggccgtgtccatggtggccctgatgcgcatcttccga
gaccagtccctctctcaccaccacaccatggttgtccaggccatcaccttcatcttcaag
tccctggggctcaagtgcgtgcagttcctgccccaggtcatgcccacattcctgaatgtc
attcgggtttgtgacggggccatccgggaatttctgttccagcagctgggaatgttggtg
tcctttgtgaagagccacatcagaccttacatggatgagatagtcacgctcatgagagaa
ttctgggtcatgaacacctccatccagagcacaatcattctcctcattgagcagattgtg
gtagccctcgggggtgaatttaagctctacctgccccagctgattccacacatgcttcgt
gtcttcatgcatgacaatagctcaggccgcatcgtctccatcaagttgctggctgcaatc
cagctgttcggtgccaacctggatgactatctgcatttgttgctgcccccgatcgtgaag
ttatttgacgcccccgaagccccattgccttctcgaaaggccgcgctagagactgtggac
cgtctgacagagtctctggatttcacggactatgcctctcggatcattcatccgattgta
cgcacactggaccagagcccagaactccgttccacagcaatggacacgttgtcttcactc
gtctttcagctgggaaagaagtaccaaattttcattccaatggtgaacaaagttctggtg
agacaccgaatcaaccatcagcgctacgacgtcctcatctgcaggatagtcaaggggtat
accctggctgacgaggaggaggaccctctgatttaccagcatcgaatgctgaggagcagc
caaggtgatgccttagccagtggaccagtggaaacggggcccatgaagaaactgcacgtc
agcaccatcaacctccaaaaggcctggggagctgccagaagggtttccaaagatgattgg
ttggaatggctgcggcggctgagcctggagctgctgaaggactcctcgtcaccctccctg
cgctcctgctgggccctggcacaggcctacaacccgatggccagggatctctttaacgct
gcgtttgtgtcctgctggtctgagctgaatgaggaccagcaggatgagctcatcagaagc
atcgagttggccctcacctcccaggacatcgcagaagtcacgcaaaccctcttaaatttg
gctgaattcatggaacacagtgacaagggccccctgcctttgagagatgacaatggcatt
gtcctgctgggcgagagagctgccaagtgccgagcatatgccaaagcgctgcactacaaa
gaactggagttccagaaaggtcccacccctgccattctcgagtctctcatcagcattaat
aataagctgcagcagccagaggcagctgctggggtgttggagtatgccatgaagcacttt
ggagagctggagatccaggctacctggtatgagaagctgcacgagtgggaagatgctctc
gtggcctatgataagaaaatggacaccaacaaggacgacccagagctgatgctgggccgc
atgcgctgcctcgaggccttgggggaatgggggcagcttcaccagcagtgctgtgaaaaa
tggactctggttaatgatgagacccaagccaagatggcccgcatggctgctgcagctgca
tggggtttaggtcagtgggacagcatggaagagtacacctgtatgatccctcgggacacc
cacgacggggcgttttatagagctgtgctggcgctacatcaggacctcttctccttggca
caacagtgcatcgacaaagcccgggacctactagacgcggagttaacggcgatggcggga
gagagctacagccgggcctatggggccatggtttcttgccacatgctgtctgagctggag
gaggttatccagtacaaacttgtgcccgagcgacgggagatcatccgccagatctggtgg
gagagactgcagggctgccagcgtattgtggaggactggcagaaaatcctcatggtgcgg
tcactcgtcgtcagccctcacgaggacatgaggacctggctcaagtacgcaagcctgtgt
ggcaagagtggcaggctggcacttgctcacaaaaccttagtgctgctcctgggagttgat
ccatctcggcaacttgaccatcctctgccaacagttcacccccaggtgacctacgcctac
atgaaaaatatgtggaagagcgcccgcaagattgatgccttccagcacatgcagcacttt
gttcagaccatgcagcagcaagcccagcatgccatcgccaccgaggaccagcagcacaag
caggagctgcacaagctcatggcccgatgtttcctgaaactcggggagtggcagctgaac
ctacagggcatcaacgagagcacgatccccaaagtcctgcagtactacagcgccgccaca
gagcacgaccgcagctggtacaaggcctggcatgcgtgggcagtgatgaactttgaggct
gtgctccactacaaacatcagaaccaagcccgcgacgagaagaagaagctgcgacacgcc
agtggggccaacatcactaacgcagccactgctgctaccacagcggccacggccaccgcc
accaccaccagcaccgagggcagcaacagcgagagcgaggctgagagcgccgagaacagc
cctaccccgtctcctctgcagaagaaggtcactgaggatttgtccaaaaccctcttgatg
tacactgtccctgctgtccagggcttcttccgttccatctccttgtcacgaggcaacaac
ctccaggacacgctcagagtcctcaccttatggtttgattatggtcactggccagatgta
aatgaagccttagtggaaggggtgaaagcaatccagattgacacttggttacaggttata
cctcagctcattgcaagaattgatacgccaaggcccctggtgggacgtcttatccaccag
cttctcacagacattggtcggtaccacccccaggccctcatctacccactgacagtggcc
tccaagtccaccaccacagcccggcacaacgcagccaacaaaatcctgaagaacatgtgc
gaacacagcaacaccctggtgcagcaggccatgatggtgagtgaggagctgatccgagtg
gccatcctctggcacgagatgtggcatgaaggcctggaagaggcgtctcgcttgtacttt
ggggagaggaacgtgaaaggcatgttcgaggtgctggaacccctgcacgccatgatggag
cggggaccccagacactgaaggaaacatcctttaaccaggcatatggtcgagatttaatg
gaggcccaggaatggtgcaggaagtacatgaaatcagggaatgtcaaggacctcacccaa
gcctgggacctctattaccacgtattcagacgaatctccaagcagctgcctcagctcaca
tccttagagctgcagtacgtctcccccaaacttctgatgtgccgggatctggaactggct
gtgccgggaacttacgaccccaaccagcccatcattcgcattcagtccatcgcgccgtct
ctgcaagtcatcacatccaaacagaggccccggaagctgacgcttatgggcagcaacggg
cacgagtttgtcttcctcctgaagggccatgaggacttgcggcaggacgaacgggtgatg
cagctcttcggcctggtcaacacccttctggccaatgacccgacgtctcttcggaaaaac
ctcagcatccagagatacgctgtcattccattatcaaccaactcgggcctcatcggctgg
gtcccccactgtgacacactgcacgccctcatccgggactacagggagaaaaagaagatc
cttctcaacattgagcatcgcatcatgctgcggatggctccagactatgaccacctaact
ctgatgcagaaggtcgaggtgtttgagcacgccgtcaacaacacagctggggacgacctg
gccaaactgctgtggctgaagagccccagctccgaggtgtggtttgatcgaagaaccaat
tatacccgctctttagcggtcatgtctatggttgggtatattttgggcctgggcgataga
cacccatccaacctgatgctggaccggctgagtggaaagatcctgcacattgactttggg
gactgctttgaggttgctatgaccagagagaaattcccagagaaaattccatttagacta
acaagaatgctgaccaatgctatggaggtcacgggccttgatggcaactacaggatcacg
tgccacactgtgatggaggtgctccgggagcacaaggacagcgtcatggccgtgctggaa
gccttcgtcnntctgctgaactggaggctgatggacacaaataccaaaggtaacaagcga
tcacggacgaggacagattcctactctgctggccagtcagtagaaattttggatggtgtg
gaacttggggaaccagcccataagaaaacggggaccacagtgccagaatctattcattct
ttcattggagatggtttggtaaaaccagaggccctaaataagaaagcaattcaaattatt
aacagggttcgagataagctcactggtcgggacttctctcatgacgaaaccctggatgtc
ccaacacaagtcgagctgctcatcaaacaagcgacatcccatgaaaacctctgccagtgc
tacattggctggtgtcctttctggtaa

DBGET integrated database retrieval system