KEGG   Bos mutus (wild yak): 102281756
Entry
102281756         CDS       T02919                                 

Gene name
CREB1
Definition
(RefSeq) cAMP responsive element binding protein 1
  KO
K05870  cyclic AMP-responsive element-binding protein 1
Organism
bom  Bos mutus (wild yak)
Pathway
bom04022  cGMP-PKG signaling pathway
bom04024  cAMP signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04152  AMPK signaling pathway
bom04211  Longevity regulating pathway
bom04261  Adrenergic signaling in cardiomyocytes
bom04380  Osteoclast differentiation
bom04612  Antigen processing and presentation
bom04668  TNF signaling pathway
bom04710  Circadian rhythm
bom04713  Circadian entrainment
bom04714  Thermogenesis
bom04725  Cholinergic synapse
bom04728  Dopaminergic synapse
bom04911  Insulin secretion
bom04915  Estrogen signaling pathway
bom04916  Melanogenesis
bom04918  Thyroid hormone synthesis
bom04922  Glucagon signaling pathway
bom04924  Renin secretion
bom04925  Aldosterone synthesis and secretion
bom04926  Relaxin signaling pathway
bom04927  Cortisol synthesis and secretion
bom04928  Parathyroid hormone synthesis, secretion and action
bom04931  Insulin resistance
bom04934  Cushing syndrome
bom04935  Growth hormone synthesis, secretion and action
bom04962  Vasopressin-regulated water reabsorption
bom05016  Huntington disease
bom05020  Prion disease
bom05030  Cocaine addiction
bom05031  Amphetamine addiction
bom05034  Alcoholism
bom05152  Tuberculosis
bom05161  Hepatitis B
bom05163  Human cytomegalovirus infection
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05203  Viral carcinogenesis
bom05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    102281756 (CREB1)
   04024 cAMP signaling pathway
    102281756 (CREB1)
   04022 cGMP-PKG signaling pathway
    102281756 (CREB1)
   04151 PI3K-Akt signaling pathway
    102281756 (CREB1)
   04152 AMPK signaling pathway
    102281756 (CREB1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    102281756 (CREB1)
  09152 Endocrine system
   04911 Insulin secretion
    102281756 (CREB1)
   04922 Glucagon signaling pathway
    102281756 (CREB1)
   04915 Estrogen signaling pathway
    102281756 (CREB1)
   04926 Relaxin signaling pathway
    102281756 (CREB1)
   04935 Growth hormone synthesis, secretion and action
    102281756 (CREB1)
   04918 Thyroid hormone synthesis
    102281756 (CREB1)
   04928 Parathyroid hormone synthesis, secretion and action
    102281756 (CREB1)
   04916 Melanogenesis
    102281756 (CREB1)
   04924 Renin secretion
    102281756 (CREB1)
   04925 Aldosterone synthesis and secretion
    102281756 (CREB1)
   04927 Cortisol synthesis and secretion
    102281756 (CREB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102281756 (CREB1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102281756 (CREB1)
  09156 Nervous system
   04725 Cholinergic synapse
    102281756 (CREB1)
   04728 Dopaminergic synapse
    102281756 (CREB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102281756 (CREB1)
  09149 Aging
   04211 Longevity regulating pathway
    102281756 (CREB1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    102281756 (CREB1)
   04713 Circadian entrainment
    102281756 (CREB1)
   04714 Thermogenesis
    102281756 (CREB1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102281756 (CREB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    102281756 (CREB1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    102281756 (CREB1)
   05020 Prion disease
    102281756 (CREB1)
  09165 Substance dependence
   05030 Cocaine addiction
    102281756 (CREB1)
   05031 Amphetamine addiction
    102281756 (CREB1)
   05034 Alcoholism
    102281756 (CREB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102281756 (CREB1)
   04934 Cushing syndrome
    102281756 (CREB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102281756 (CREB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102281756 (CREB1)
   05161 Hepatitis B
    102281756 (CREB1)
   05163 Human cytomegalovirus infection
    102281756 (CREB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102281756 (CREB1)
   05165 Human papillomavirus infection
    102281756 (CREB1)
Transcription factors [BR:bom03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    102281756 (CREB1)
Mitochondrial biogenesis [BR:bom03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    102281756 (CREB1)
SSDB
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 102281756
NCBI-ProteinID: XP_005907095
UniProt: L8HUZ8
LinkDB
Position
Un
AA seq 341 aa
MTMESGAENQQSGDAAVTEAESQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG
QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV
VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgaccatggaatctggagcagagaaccagcagagtggagatgcagctgtaacagaagct
gaaagccagcaaatgacagttcaagcccagccacagattgccacattagcccaggtatct
atgccagcagctcatgcaacatcatctgctcccaccgtaactttagtacagctgcccaat
gggcagacagttcaagtccatggagttattcaggcggcccagccatcagttattcagtct
ccacaagtccagacagttcagtcttcctgtaaggacttaaaaagacttttctccggaact
cagatttcaactattgcagaaagtgaagattcacaggagtcagtggatagtgtaaccgat
tcccaaaaacgaagagagattctttcaaggaggccttcctacaggaaaattttgaatgac
ttatcttctgatgcaccaggagtgccaaggattgaagaagagaaatctgaagaggagact
tcagcacctgccatcaccactgtcacggtgccaactccgatttatcagactagcagtgga
cagtatattgccattacccaaggaggagcaatacaactggctaacaatggtactgatggg
gtacagggcctgcagacattaaccatgaccaatgcagctgccactcagccaggtactacc
atcctgcagtatgcacagaccactgatggacagcaaatcctagtgcccagcaaccaagtt
gttgttcaagctgcctctggagatgtacagacataccagattcgcacagcgcccactagc
accattgcccctggagttgttatggcgtcttccccagcacttcctacacagcctgctgaa
gaagcggcgcgaaagagagaggttcgcctcatgaagaacagggaagcagcacgagagtgt
cgtagaaagaagaaagaatatgtgaaatgtctagaaaacagagtggcagtgcttgaaaat
caaaacaagacactgattgaggagctaaaagcacttaaggacctttactgccacaaatca
gattaa

DBGET integrated database retrieval system