KEGG   Bos mutus (wild yak): 102282588Help
Entry
102282588         CDS       T02919                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
bom  Bos mutus (wild yak)
Pathway
bom04371  Apelin signaling pathway
bom05034  Alcoholism
bom05165  Human papillomavirus infection
bom05169  Epstein-Barr virus infection
bom05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102282588 (HDAC4)
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    102282588 (HDAC4)
  09164 Substance dependence
   05034 Alcoholism
    102282588 (HDAC4)
  09167 Infectious diseases
   05169 Epstein-Barr virus infection
    102282588 (HDAC4)
   05165 Human papillomavirus infection
    102282588 (HDAC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bom03036]
    102282588 (HDAC4)
Enzymes [BR:bom01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102282588 (HDAC4)
Chromosome and associated proteins [BR:bom03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     102282588 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln Oxidored_nitro
Motif
Other DBs
NCBI-GeneID: 102282588
NCBI-ProteinID: XP_005906457
LinkDB All DBs
Position
Un
AA seq 1167 aa AA seqDB search
MWSDGSLCRVKGTCGSGSAIVVVRTQSKDGLSGRDQPVELLNPARVNHMPSTVDVASALP
LPVAPPGVPMDLRLDHQFPLPVAEPGLREQQLQQELLALKQKQQLQRQILIAEFQRQHEQ
LSRQHEAQLHEHIKQQQELLAMKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKE
KGKESAVASTEVKMKLQEFVLNKKKALAHRNLNHCMSSDPRYWYGKTQHSSLDQSSPPQS
GASASYNHPVLGMYDAKDDFPLRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTA
LKKRPLDVTDSACSSAPGSAPSSPNNSSGNVSTENGIAPAVPSIPAETSLAHRLVAREGS
VGPLPLYTSPSLPNITLGLPATGPSTGAAGQQEAERLALPALQQRISLFPGTHLAPYLGA
APLERDAGAAPGSLLQHVVLLEQPPTQTPLVTGLGALPLHAQPLVGAERVAPSVHKLRQH
RPLGRTQSAPLPQSTQALQHLVIQQQHQQFLEKHKQHFQQPQLHLNKMIPKPSEPARQPE
SHPEETEEELREHQALLEEPFLDRLPGQKEAHALAGVQVKQEPIESDDEETEPPREAEPG
QRPPTEQELLFRQQALLLEQQRIHQLRNYQASMEAAGIPVSFGGHRPLSRAQSSPASATF
PMSVQEPPAKPRFTTGLVYDTLMLKHQCTCGNTNSHPEHAGRIQSIWSRLQETGLRGKCE
CIRGRKATLEELQTVHSETHALLYGTNPLNRQKLDSKKLLGSLTSVFVRLPCGGVGVDSD
TIWNEVHSSGAARLAVGCVVELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVA
IAAKLLQQRLSVSKTLVVDWDVHHGNGTQQAFYSDPRVLYISLHRYDDGNFFPGSGAPDE
VGTGAGVGFNVNMAFTGGLDPPMGDAEYLAAFRTVVMPIASEFAPDVVLVSSGFDAVEGH
PTPLGGYNLSAKCFGYLTKQLMGLAGGRVVLALEGGHDLTAICDASEACVSALLGNELDP
LPEKVLQQRPNANAVRSMEKVIEIHSQYWRSLQRLASTAGYSLVEAQKCENEEAETVTAM
ASLSVAVKAPEKSVLKASEGPPGAQPLKKPAAGGGGWGDMVQDTSRKAKAQGRQLSCHAG
PLGGPPEHRPASEGCRQHCDRPAAMLT
NT seq 3504 nt NT seq  +upstreamnt  +downstreamnt
atgtggtctgatggcagcctgtgccgagtgaaaggcacgtgtggttccggttctgccatc
gttgtggtcagaacacagtcgaaagatggactttctggccgagaccagccggtggagctg
ctcaaccctgcccgcgtgaaccacatgcccagcaccgtggacgtggcctcggccctgcct
ctgccagtggcccccccgggggtgcccatggacctgcgcctggaccaccagtttccgctg
cccgtggcggagccgggcctccgcgagcagcagctgcagcaggagctcctggcgctcaag
cagaagcagcagctgcagagacagatcctcatcgctgagttccagaggcagcacgagcag
ctgtcgcggcagcacgaggcccagctgcacgagcacatcaagcaacagcaggagctgctg
gccatgaagcaccagcaggagctgctcgagcaccagcggaagctggagcggcaccggcag
gagcaggagctggagaagcagcaccgggagcagaagctgcagcagctgaagaacaaggag
aagggcaaagagagcgccgtggccagcacggaagtgaagatgaagctgcaggagtttgtc
ctcaataaaaagaaggccctggctcaccggaacctgaaccactgcatgtccagcgaccct
cgctactggtacgggaagacgcagcacagctcgctggaccagagctccccgccccagagc
ggggcgtcagcctcctacaaccacccagtcctgggcatgtatgacgccaaagacgacttc
cccctcagaaagacagcttctgaacccaacctgaaattacgctccaggctaaagcagaaa
gtggctgagagacggagcagccccctgctacgcaggaaagatgggccagtggtcacggct
ctgaaaaagcgtcccttggatgtcacagactcagcgtgcagcagtgccccaggctccgcg
cccagctcgcccaacaacagctctgggaacgtgagcacggagaacgggatcgcgcccgct
gtccccagcatcccagccgagaccagcctggcacacagactcgtggcacgagagggctcg
gtgggcccgctgcccctctacacgtcaccatccctgcccaacatcacactggggctgccc
gccaccggcccctccacgggggcggccggccagcaggaggccgagagactggccctcccc
gccctgcagcagcgcatctccctcttccctggtacccacctcgccccctacctgggcgca
gcacctctggagcgggacgcgggggcagccccaggctccctcttgcagcatgtggtcctc
ctggagcagccgcccacgcagacgcccctcgtcacaggcctgggcgcgctgcccctgcac
gcgcagcccctggtaggggcggagcgagtggcgccctcggtgcacaagctgcggcagcac
cgcccgctgggccgcacgcagtcggcgccgctgccccagagcacgcaggcgctgcagcac
ctggtcatccagcagcagcaccagcagttcctggagaagcacaagcagcacttccagcag
ccgcagctgcacctcaacaagatgatccccaaacccagcgagccggcccggcagcccgag
agccaccccgaggagacagaggaggagctgcgggagcaccaggcgctcctggaggagccc
ttcctggaccggctcccagggcagaaggaggcccacgcactggccggggtgcaggtgaag
caggagcccatcgagagtgatgacgaggagacggagcccccgcgggaggcggagcccggc
cagcggccgcccacagagcaggagctgctcttcagacagcaagccctcctcctggagcag
cagcggatccaccagctgaggaactaccaggcgtccatggaggctgctggcatccccgtg
tcctttggcgggcaccggcccctgtcccgggcacagtcctcccccgcatccgccaccttc
cccatgtccgtgcaggagcccccagccaagccaaggttcaccacaggcctcgtgtacgac
actctgatgctgaaacaccagtgcacctgtgggaacaccaacagccacccagagcacgcc
gggcgcatccagagcatctggtcgcggctgcaggagaccggcctgcgaggcaaatgtgag
tgcatccgcggacgtaaggccacgctggaggagctgcagacagtgcactcggagacacac
gccctgctgtacggcacgaaccccctcaacaggcagaaactggacagtaagaaacttcta
ggctcactaacgtccgtgttcgtcaggctgccctgcggtggtgtcggggtggacagtgac
accatatggaacgaggtgcactcgtcgggggccgcccgcctggccgtgggctgtgtggta
gagctggtcttcaaggtggccacgggggagctgaagaatggctttgctgtggtccgccct
ccaggacaccacgcagaggagagcacgcccatggggttctgctacttcaactccgtggcc
atcgctgccaagcttctccagcaaaggctgagcgtgagcaagaccctcgtggtggactgg
gatgtgcaccacgggaacgggacccagcaggccttctacagcgacccccgcgtgctctac
atctccctgcaccgctacgacgacggcaacttcttcccgggcagcggcgcgcctgacgag
gtgggcacgggcgccggcgtgggctttaacgtcaacatggctttcaccggcggcctggac
ccccccatgggagacgcagagtacctcgcagccttcaggaccgtggtcatgccgatcgcc
agcgagttcgccccggacgtggtgctggtgtcctcaggcttcgacgccgtggagggccac
cccacgcccctcggaggctacaacctctccgccaagtgtttcgggtacctgacaaagcag
ctgatgggcctggccggcggccgggttgtcctggcgctggaggggggccacgatctcaca
gccatctgcgacgcctcggaagcctgcgtctctgccctgctggggaatgagctcgatcct
ctcccagaaaaggtcttacagcagagacccaatgccaacgccgtgcggtcgatggagaag
gtcattgaaatccacagccagtactggcgctccctgcagaggcttgcctccaccgctggc
tactccctggtcgaggcccagaagtgtgagaacgaggaagccgagactgttactgccatg
gcctcgctgtctgtggcggtgaaggcccctgagaagagtgtgctgaaggcctcggagggt
ccccctggggcacagcccctgaagaagccagctgccgggggcgggggatggggggacatg
gtgcaggacaccagccgcaaggcgaaggcccaggggaggcagctgagctgtcatgcagga
cccctaggaggaccacctgagcaccgcccagcctccgagggctgccgtcagcactgtgac
cgccctgccgcaatgctgacttaa

DBGET integrated database retrieval system