KEGG   Bos mutus (wild yak): 102282598
Entry
102282598         CDS       T02919                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
bom  Bos mutus (wild yak)
Pathway
bom01521  EGFR tyrosine kinase inhibitor resistance
bom04010  MAPK signaling pathway
bom04014  Ras signaling pathway
bom04015  Rap1 signaling pathway
bom04020  Calcium signaling pathway
bom04072  Phospholipase D signaling pathway
bom04144  Endocytosis
bom04151  PI3K-Akt signaling pathway
bom04510  Focal adhesion
bom04540  Gap junction
bom04630  JAK-STAT signaling pathway
bom04810  Regulation of actin cytoskeleton
bom05163  Human cytomegalovirus infection
bom05200  Pathways in cancer
bom05206  MicroRNAs in cancer
bom05214  Glioma
bom05215  Prostate cancer
bom05218  Melanoma
bom05230  Central carbon metabolism in cancer
bom05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102282598 (PDGFRA)
   04014 Ras signaling pathway
    102282598 (PDGFRA)
   04015 Rap1 signaling pathway
    102282598 (PDGFRA)
   04630 JAK-STAT signaling pathway
    102282598 (PDGFRA)
   04020 Calcium signaling pathway
    102282598 (PDGFRA)
   04072 Phospholipase D signaling pathway
    102282598 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    102282598 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102282598 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102282598 (PDGFRA)
   04540 Gap junction
    102282598 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102282598 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102282598 (PDGFRA)
   05206 MicroRNAs in cancer
    102282598 (PDGFRA)
   05230 Central carbon metabolism in cancer
    102282598 (PDGFRA)
   05231 Choline metabolism in cancer
    102282598 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    102282598 (PDGFRA)
   05218 Melanoma
    102282598 (PDGFRA)
   05215 Prostate cancer
    102282598 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102282598 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102282598 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bom01001]
    102282598 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:bom04090]
    102282598 (PDGFRA)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102282598 (PDGFRA)
Protein kinases [BR:bom01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   102282598 (PDGFRA)
CD molecules [BR:bom04090]
 Proteins
  102282598 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Herpes_gE V-set C2-set_2 Kinase-like LAT
Other DBs
NCBI-GeneID: 102282598
NCBI-ProteinID: XP_005907695
UniProt: L8HUZ5
LinkDB
Position
Un
AA seq 1089 aa
MGTSHWALLVLGCLFTGPSLILCQLSLPSILPNENERVVQLNSSFSLRCFGESEVSWQYP
MSEEEYPDVEIRNEENNSGLFVTVLEVVSASAAHTGLYTCYYNHTQMDENEIEGRHIYIY
VPDPDVAFVPLGMTDSLVIVEDEDSVIIPCRTTDPETPVTLLSSEGIVPASYDSRQGFKG
TFSVGLYICEATVRGKKFQTIPFNVYAYTATSKLDLEMESPKTVYKAGESIVVTCTVFNN
EVVDFQWTYPGQMKGKGITRLEETKFPSIKLVYTLRVPEATVKDSGDYECAAHQATKEVK
KMRNVTISVHEKGFIEIKPNFNLLEAVNLHEVKHFVVDVQAYPPPKITWLKDNLTLIENL
TEITTDIEKIQEISYRSKLKLIRAKEEDSGHYTIVVQNEDDVKSYTFELLTQVPSSILDL
VDNHHGSNGGQTVRCTAEGTPLPDIEWMVCKDIKKCNNETSWTVLANNVSNIITGVHPRD
RSTVEGQVTFAKVEETIAVRCLAKNLLGVESRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSHHPEKPKKELDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRALYDRPASYKKKSMLDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttcccattgggcactcctggtcttaggctgtctcttcacagggccgagccta
atcctctgccagctttcattaccctccatcctgcccaatgaaaatgagagggttgtgcag
ctgaattcatccttttctctgagatgctttggggagagtgaagtgagctggcagtacccc
atgtctgaagaagagtaccccgacgtggaaatcagaaacgaggagaacaacagtggcctt
tttgtgacagtgctggaagtggtcagcgcctcggcggcccacactgggctgtacacttgc
tattacaaccacacgcagatggacgagaacgagatcgagggcaggcacatttacatctac
gtgccagacccagatgtagccttcgtacctctaggaatgacagattccttggtcatcgtg
gaggacgaagattcggtcatcatcccatgccgcacgactgatcctgagactccagtgacc
ttactcagcagtgaggggatagtgcctgcctcctatgacagcagacaaggctttaaagga
accttcagtgtcgggctctatatctgtgaggccacggtcagagggaagaagttccagacc
attccattcaatgtttatgcttacacagcaacatcaaaacttgatctggaaatggaatct
cctaagactgtgtataaggcaggcgaatcaattgtggtcacctgcaccgtctttaacaac
gaggtggttgactttcagtggacttaccctggacaaatgaaaggcaaaggcatcacgagg
ctggaggaaaccaagttcccgtccatcaagttggtgtacactctgagggttcccgaggcc
acggtgaaagacagtggagattacgaatgtgctgcccaccaggccaccaaggaggtcaaa
aagatgaggaacgtcaccatttctgttcacgagaaaggatttattgaaatcaaacccaac
tttaacctgttggaagctgtcaacctgcatgaagtcaagcattttgtggtggatgtgcag
gcctatccccctcccaagataacctggctaaaggacaacctgactctgattgagaatctc
acggagatcaccactgacatagaaaagattcaggaaataagttatcgaagcaaattaaag
ctgatccgagcaaaggaagaagacagcggccattatactattgtagttcaaaatgaagat
gatgtgaagagctatacttttgaactcttgactcaagttccatcctccatactggacttg
gttgacaaccaccatggctctaatgggggccagactgtgagatgcacagccgaagggacc
cctcttcctgatatcgagtggatggtttgcaaggatattaagaaatgtaacaatgaaact
tcatggacagttttggccaacaacgtttcaaacatcatcacaggggtccacccccgagac
aggagcacagtggaaggccaggtgacgtttgccaaagtggaggagaccattgcagtccgg
tgtctggccaagaacctcctcggggtggaaagccgagagctgaagctggtggctcccact
ctgcgctctgagctcactgtggcggctgctgtcctggtgttgttggtgattgtgatcatc
tcactcattgtcctggtcgtcatttggaaacagaaaccaaggtatgaaatccgttggagg
gtcattgaatcaatcagccctgatggacatgaatacatttatgtggacccaatgcagctg
ccttacgactcgagatgggagtttccaagagatggactcgtgcttggtcggatcctgggg
tctggtgcatttgggaaagtggttgaaggaactgcttatggattaagtcggtctcaacct
gtcatgaaagtagcagtgaagatgctaaaacccacagccagatccagtgaaaaacaagct
ctcatgtctgaactgaagataatgacccacctggggccgcatttaaacatcgtgaacttg
ctgggcgcctgcaccaagtcaggccccatttacatcatcactgagtactgcttctatggg
gatttggtcaactatttgcataagaatagggacagcttcctgagccaccatccagagaag
ccaaagaaagagctggacatttttggattgaacccggctgacgaaagcacaagaagttac
gttatcttatcttttgaaaataatggtgactacatggacatgaagcaagctgacacgaca
cagtatgtccccatgctggagagaaaagaggtttctaaatactcggacatccagagagca
ctgtatgatcgcccagcctcgtataagaagaaatccatgttagactcagaagtcaaaaac
ctcctttcagatgataactcagaaggcctgactttgttggatttgttgagctttacctat
caagtcgcccgaggaatggagtttttggcttcaaaaaattgtgtccatcgggacctggcg
gctcgcaacgtcctcctggcgcaagggaaaatcgtgaagatctgtgactttggcctggcc
agagacatcatgcatgattcgaactacgtgtccaaaggcagtacctttctccccgtgaag
tggatggctcctgagagcatctttgacaacctgtacaccacgctgagtgacgtctggtcc
tatggcatcctgctctgggagatcttttcccttggtggcacaccctaccctggcatgatg
gtggactctacattctacaataagatcaagagtggataccggatggccaagcctgaccat
gccaccagtgaagtctacgagatcatggtgaagtgctggaacagtgagccggagaagaga
ccctccttttaccacctgagtgaaattgtggagaatctgctgcctggacaatataaaaag
agttatgaaaagatccacctggactttctgaagagtgaccatcccgctgtggcacgcatg
cgcgtggactccgacaacgcctacattggcgtcacctacaaaaatgaggaagacaagctg
aaggactgggagggtggcctcgacgagcagaggctgagtgcagatagcggctacatcatc
cctctgcccgacatcgaccctgttcctgaggaggaagacctgggcaagaggaacagacac
agctcacagacctctgaagagagtgccattgagacaggttccagcagttctacgttcatc
aagagagaggatgagaccatcgaggacatcgacatgatggacgacattggcatagactcc
tcggatctggtggaggacagcttcctgtaa

DBGET integrated database retrieval system