KEGG   Bos mutus (wild yak): 102282627
Entry
102282627         CDS       T02919                                 

Gene name
SMAD3
Definition
(RefSeq) SMAD family member 3
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
bom  Bos mutus (wild yak)
Pathway
bom04068  FoxO signaling pathway
bom04110  Cell cycle
bom04144  Endocytosis
bom04218  Cellular senescence
bom04310  Wnt signaling pathway
bom04350  TGF-beta signaling pathway
bom04371  Apelin signaling pathway
bom04390  Hippo signaling pathway
bom04520  Adherens junction
bom04550  Signaling pathways regulating pluripotency of stem cells
bom04659  Th17 cell differentiation
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom05161  Hepatitis B
bom05166  Human T-cell leukemia virus 1 infection
bom05200  Pathways in cancer
bom05210  Colorectal cancer
bom05212  Pancreatic cancer
bom05220  Chronic myeloid leukemia
bom05225  Hepatocellular carcinoma
bom05226  Gastric cancer
bom05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102282627 (SMAD3)
   04350 TGF-beta signaling pathway
    102282627 (SMAD3)
   04390 Hippo signaling pathway
    102282627 (SMAD3)
   04371 Apelin signaling pathway
    102282627 (SMAD3)
   04068 FoxO signaling pathway
    102282627 (SMAD3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102282627 (SMAD3)
  09143 Cell growth and death
   04110 Cell cycle
    102282627 (SMAD3)
   04218 Cellular senescence
    102282627 (SMAD3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102282627 (SMAD3)
   04550 Signaling pathways regulating pluripotency of stem cells
    102282627 (SMAD3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102282627 (SMAD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102282627 (SMAD3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102282627 (SMAD3)
   05212 Pancreatic cancer
    102282627 (SMAD3)
   05225 Hepatocellular carcinoma
    102282627 (SMAD3)
   05226 Gastric cancer
    102282627 (SMAD3)
   05220 Chronic myeloid leukemia
    102282627 (SMAD3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102282627 (SMAD3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102282627 (SMAD3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102282627 (SMAD3)
   05161 Hepatitis B
    102282627 (SMAD3)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 102282627
NCBI-ProteinID: XP_005893353
UniProt: L8IRK1
LinkDB
Position
Un
AA seq 425 aa
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNV
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEV
CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETP
PPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPTHNNLDLQPVTYCEPAFWCSISYYEL
NQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGF
EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR
CSSVS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgtcgtccatcctgcctttcactcccccgatcgtgaagcgcctgctgggctggaaaaag
ggcgagcagaacgggcaggaggagaagtggtgcgagaaggcagtcaagagtttggtcaag
aagctcaagaaaacggggcagctggacgagctggagaaagccatcaccacgcagaacgtc
aacaccaagtgcatcaccatccccaggtccctggatggccggctgcaggtgtcccaccgg
aaggggctcccccacgtcatctactgccgcctgtggcggtggcccgacctgcacagccac
cacgagctgcgggccatggagctgtgtgagttcgccttcaacatgaagaaggacgaggtc
tgcgtgaatccctaccactatcagagggtagagaccccagttctacctcctgtgttggtg
ccccgccacacagagatcccggccgagttccccccgctggatgactacagccattccatc
cccgaaaacactaacttccctgccggcatcgagccccagagcaatattccagaaacccca
cccccaggctacctgagtgaagatggagagaccagtgaccaccagatgaaccacagcatg
gatgcaggttctccaaacctctccccgaatccgatgtccccaacacacaataacttggac
ctgcagcccgtcacctactgtgagccggccttctggtgctccatctcctactacgagctc
aaccagcgcgtcggggagacattccacgcctcccagccgtccatgacggtggatggcttc
accgacccctccaactcggagcgcttctgcctggggctgctctccaacgtcaaccggaac
gcggctgtggagctgacacggaggcatatcgggcggggtgtgcggctgtactacattgga
ggggaggtcttcgcagaatgcctcagtgacagcgccatctttgtgcagtctcccaactgt
aaccagcgctatggctggcacccagccaccgtctgcaagattccaccaggatgcaacctg
aagatcttcaacaaccaggagtttgccgccctcttggctcagtctgtcaaccagggcttc
gaggccgtgtaccagctgacccgcatgtgcaccattcgcatgagctttgtcaaaggctgg
ggagccgagtacaggagacaaactgtgaccagcaccccctgctggattgagctgcacctg
aatggacctttgcagtggcttgacaaggtcctcacccagatgggctcccctagcatccgc
tgctccagcgtgtcttag

KEGG   Bos mutus (wild yak): 102286495
Entry
102286495         CDS       T02919                                 

Gene name
SMAD2
Definition
(RefSeq) mothers against decapentaplegic homolog 2
  KO
K04500  mothers against decapentaplegic homolog 2
Organism
bom  Bos mutus (wild yak)
Pathway
bom04110  Cell cycle
bom04144  Endocytosis
bom04218  Cellular senescence
bom04350  TGF-beta signaling pathway
bom04371  Apelin signaling pathway
bom04390  Hippo signaling pathway
bom04550  Signaling pathways regulating pluripotency of stem cells
bom04659  Th17 cell differentiation
bom04926  Relaxin signaling pathway
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom05142  Chagas disease
bom05166  Human T-cell leukemia virus 1 infection
bom05200  Pathways in cancer
bom05205  Proteoglycans in cancer
bom05210  Colorectal cancer
bom05212  Pancreatic cancer
bom05225  Hepatocellular carcinoma
bom05226  Gastric cancer
bom05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    102286495 (SMAD2)
   04390 Hippo signaling pathway
    102286495 (SMAD2)
   04371 Apelin signaling pathway
    102286495 (SMAD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102286495 (SMAD2)
  09143 Cell growth and death
   04110 Cell cycle
    102286495 (SMAD2)
   04218 Cellular senescence
    102286495 (SMAD2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102286495 (SMAD2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102286495 (SMAD2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    102286495 (SMAD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102286495 (SMAD2)
   05205 Proteoglycans in cancer
    102286495 (SMAD2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102286495 (SMAD2)
   05212 Pancreatic cancer
    102286495 (SMAD2)
   05225 Hepatocellular carcinoma
    102286495 (SMAD2)
   05226 Gastric cancer
    102286495 (SMAD2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102286495 (SMAD2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102286495 (SMAD2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102286495 (SMAD2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102286495 (SMAD2)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 102286495
NCBI-ProteinID: XP_005901451
LinkDB
Position
Un
AA seq 470 aa
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDE
LEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPXXXXIEPQSNYIPETPPPGYISEDGETSDQQLN
QSMDTGSPAELSPTTLLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSL
TVDGFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFV
QSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMS
FVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgtcgtccatcttgccattcactccaccagttgtgaagagactgttgggatggaagaag
tcagctggtggatctggaggagctggtggaggagagcagaatggacaggaagaaaagtgg
tgtgagaaagcagttaaaagtttggtgaagaagctgaagaaaacaggacgattagatgag
cttgagaaagccatcaccactcagaattgtaatactaaatgtgttaccataccaagcact
tgctctgaaatttggggactgagtacaccaaatacgatagatcagtgggatacaacaggc
ctttacagcttctctgaacaaaccaggtctctagatggtcgtcttcaggtgtcccatcga
aaaggactgcctcatgtaatatattgccgattatggcgctggcctgatcttcacagtcat
catgaactcaaagcaattgaaaactgcgaatatgcttttaatcttaaaaaggatgaagta
tgtgtaaacccttaccactaccagagagttgagacaccagttctgcccccggtgctggtg
ccccggcatacggagatcctaacggaactgccccctctggatgactacacccactccatt
ccagaaaacactaacttcccagnnnnnnnnnnaatcgagccacagagtaattatatccca
gaaacgccacctcctggatatatcagtgaagatggagaaacaagtgatcaacagttgaac
caaagtatggatacaggatctccagcagaattatctcctactactcttctttcccctgtt
aatcatagtttggacttgcagccagttacttactcagagcctgcgttttggtgttcaata
gcatattatgaattaaaccagagggttggagagaccttccatgcctcacagccctcgctc
accgtagacggcttcacagatccatcaaattctgagaggttctgcctaggtttactctcc
aacgtaaacagaaatgctacggtagaaatgacaagaagacacataggaagaggagtgcgc
ttatattacataggtggggaagtttttgccgagtgcctaagtgacagtgcaatctttgtg
cagagccccaactgtaatcagagatacggctggcaccctgcaaccgtgtgtaaaattcca
ccaggctgtaatctgaagatcttcaacaaccaggaatttgctgctctgctggctcagtcc
gttaatcagggttttgaagccgtgtatcagctaactagaatgtgcaccataagaatgagt
tttgtgaaagggtggggagcagaataccgaaggcagacggtaacaagcactccttgctgg
attgaacttcatctgaatggacctctacagtggttggacaaagtattaactcagatggga
tccccttcagtgcgttgctcaagcatgtcataa

DBGET integrated database retrieval system