KEGG   Bos mutus (wild yak): 102282732
Entry
102282732         CDS       T02919                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00230  Purine metabolism
bom01100  Metabolic pathways
bom01522  Endocrine resistance
bom04015  Rap1 signaling pathway
bom04020  Calcium signaling pathway
bom04022  cGMP-PKG signaling pathway
bom04024  cAMP signaling pathway
bom04062  Chemokine signaling pathway
bom04072  Phospholipase D signaling pathway
bom04114  Oocyte meiosis
bom04211  Longevity regulating pathway
bom04213  Longevity regulating pathway - multiple species
bom04261  Adrenergic signaling in cardiomyocytes
bom04270  Vascular smooth muscle contraction
bom04371  Apelin signaling pathway
bom04540  Gap junction
bom04611  Platelet activation
bom04713  Circadian entrainment
bom04714  Thermogenesis
bom04723  Retrograde endocannabinoid signaling
bom04724  Glutamatergic synapse
bom04725  Cholinergic synapse
bom04727  GABAergic synapse
bom04740  Olfactory transduction
bom04750  Inflammatory mediator regulation of TRP channels
bom04911  Insulin secretion
bom04912  GnRH signaling pathway
bom04913  Ovarian steroidogenesis
bom04914  Progesterone-mediated oocyte maturation
bom04915  Estrogen signaling pathway
bom04916  Melanogenesis
bom04918  Thyroid hormone synthesis
bom04921  Oxytocin signaling pathway
bom04923  Regulation of lipolysis in adipocytes
bom04925  Aldosterone synthesis and secretion
bom04926  Relaxin signaling pathway
bom04927  Cortisol synthesis and secretion
bom04928  Parathyroid hormone synthesis, secretion and action
bom04934  Cushing syndrome
bom04935  Growth hormone synthesis, secretion and action
bom04962  Vasopressin-regulated water reabsorption
bom04970  Salivary secretion
bom04971  Gastric acid secretion
bom04972  Pancreatic secretion
bom04976  Bile secretion
bom05032  Morphine addiction
bom05163  Human cytomegalovirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05200  Pathways in cancer
bom05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102282732 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102282732 (ADCY3)
   04371 Apelin signaling pathway
    102282732 (ADCY3)
   04020 Calcium signaling pathway
    102282732 (ADCY3)
   04072 Phospholipase D signaling pathway
    102282732 (ADCY3)
   04024 cAMP signaling pathway
    102282732 (ADCY3)
   04022 cGMP-PKG signaling pathway
    102282732 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102282732 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102282732 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102282732 (ADCY3)
   04062 Chemokine signaling pathway
    102282732 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    102282732 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    102282732 (ADCY3)
   04912 GnRH signaling pathway
    102282732 (ADCY3)
   04913 Ovarian steroidogenesis
    102282732 (ADCY3)
   04915 Estrogen signaling pathway
    102282732 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    102282732 (ADCY3)
   04921 Oxytocin signaling pathway
    102282732 (ADCY3)
   04926 Relaxin signaling pathway
    102282732 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    102282732 (ADCY3)
   04918 Thyroid hormone synthesis
    102282732 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    102282732 (ADCY3)
   04916 Melanogenesis
    102282732 (ADCY3)
   04925 Aldosterone synthesis and secretion
    102282732 (ADCY3)
   04927 Cortisol synthesis and secretion
    102282732 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102282732 (ADCY3)
   04270 Vascular smooth muscle contraction
    102282732 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    102282732 (ADCY3)
   04971 Gastric acid secretion
    102282732 (ADCY3)
   04972 Pancreatic secretion
    102282732 (ADCY3)
   04976 Bile secretion
    102282732 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102282732 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    102282732 (ADCY3)
   04727 GABAergic synapse
    102282732 (ADCY3)
   04725 Cholinergic synapse
    102282732 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    102282732 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    102282732 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    102282732 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    102282732 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    102282732 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102282732 (ADCY3)
   04714 Thermogenesis
    102282732 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102282732 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    102282732 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102282732 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102282732 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102282732 (ADCY3)
   05163 Human cytomegalovirus infection
    102282732 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102282732 (ADCY3)
Enzymes [BR:bom01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102282732 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA Peptidase_S49_N
Other DBs
NCBI-GeneID: 102282732
NCBI-ProteinID: XP_005895740
LinkDB
Position
Un
AA seq 1145 aa
MPRTQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSGDKLAPLAVAGVGLVLDII
LFVLCKKGLLPNRVTRRVVPYLLWLLISAQVFSYLGLNFSRAHAASDTVGWQAFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQDGLKGVQLLREILANVFLYLCAIVVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGEGGSRCD
YLEEKGIETYLIIASKPEVKKTAAQNGLNGSVTPNGAPPSSKPSSPALIETKESNGSIHT
SGSISEEPEEQDAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESA
QVVKKRNTFLLSMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLLCTAVVEILIDPWLMTN
YVTFVVGEALLLILTICSLAAIFPRAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMAN
VVDMLSCLQYYTGPTNGTAEMQVEDGCVENPKYYNYVAVLSLIATIMLVQVSHMVKLTLM
LLIAGAVAVINIYAWCPIFDDYDRKRFQQHDFPMVALEKMQVFSSSGLNGTDRLPLVPSK
YSMTVMIFVMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEH
VARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDF
DSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFTSSNKDEKSDKERWQHLADLADF
ALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGV
MGNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGRDKLATFPNGASITLPHQ
VVDNS
NT seq 3438 nt   +upstreamnt  +downstreamnt
atgccgaggacccagggcttctccgagcccgagtactccgcggagtactcggccgagtac
tctgtcagcctgccttcggaccctgaccgcggggtgggccggacccatgaaatctctgtc
cggaactcggggtcgtgcctctgcttgcctcgcttcatgcggctgaccttcgtaccagag
tccttggagaacctgtaccagacctacttcaagaggcagcgccacgagaccctgctggtg
ctggtggtcttcgcggccctcttcgactgctatgtggtggtcatgtgcgctgtggtcttc
tctggcgacaagctggcccccctggccgtggctggggtcgggctggtgttggacatcatc
cttttcgtgctctgcaaaaaggggctgctccccaaccgggtcactcggagagtggtgccc
tacctgctgtggctgctgatatcagcccaggtcttctcctacctgggcctgaacttctcc
cgtgcccacgcggccagcgacacggtgggctggcaggccttcttcgtcttctccttcttc
atcacgctgccgctcagcctcagccccattgtcatcatctccgtggtctcctgcgtcgtg
cacacactcgtcttaggggtcactgtggcccagcagcagcaggatgggctgaagggagtg
cagttgctgagggagattctggccaacgtcttcctctacctgtgcgccatcgtcgtgggc
atcatgtcctactacatggcagaccgcaagcaccgcaaggccttcctggaggcccgccag
tctctggaggtgaagatgaacctggaggagcagagtcagcagcaggagaaccttatgctc
tccatcctgcccaagcacgtggccgacgagatgctgaaggacatgaagaaggatgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccgccatgagaacgtcagcatc
ctctttgctgatatcgtgggcttcacccagctgtcctcagcctgcagcgcccaggagctt
gtgaagctgctcaatgagctctttgcccgcttcgacaagctggcggctaaataccaccag
ctgcggattaagatcctgggcgactgttactactgcatctgtgggctgcctgactaccgg
gaggaccacgccgtctgctccatcctcatggggctcgccatggtggaggccatctcgtac
gtgcgggagaagacgaagaccggggtggacatgcgcgtgggggtgcacacgggcaccgtg
ctggggggcgtcctcggccagaaacgctggcagtacgacgtgtggtccaccgacgttacc
gtggccaacaagatggaggctggcggcatccctgggcgcgtgcacatctcccagagcacc
atggactgcctgaaaggagagttcgacgtggagccgggcgaggggggcagtcgctgtgat
tacctggaagagaagggcatcgagacctacctcatcatcgcgtccaagccagaggtgaag
aagacagctgcccaaaacggcctcaacggctcggtgaccccaaacggggcgccgccttcc
tcaaagcccagctcccctgccctcattgagaccaaggagtccaacgggagcattcacacc
agcggctctatatctgaggagcccgaggagcaagatgcccaggccgacaacccctcgttc
cccaaccctcgccggaggctgcgccttcaggacctggctgatcgcgtggtggacgcctcc
gaggacgagcatgagctcaaccagctactcaacgaggcgctgctagagcgggagtctgcc
caggtagtgaagaagagaaacaccttcctcctgtccatgcggttcatggaccccgagatg
gaaacccgctactcggtggagaaggagaagcagagcggggctgccttcagctgctcctgc
gttgtcctgctctgcacggccgtggtggagatcctcattgacccctggctcatgacgaac
tatgtgacctttgtggttggggaggctctgctcctgatcctgacaatctgctcgctggct
gccatctttccgcgggcctttcctaagaagctcgtggccttctctacttggattgaccgg
acgcgctgggccaggaacacctgggccatgctggccatcttcattcttgtcatggcaaac
gtggtggacatgctcagctgtctccagtactacacaggacccaccaacggcaccgcagag
atgcaggtggaggatggctgtgtggagaaccccaagtattacaactacgtggccgtgctg
tccctcatcgccaccatcatgctggtgcaggtcagccacatggtcaagctcacactcatg
ctgctcatcgcgggggccgtggctgtcatcaacatctacgcctggtgccccatctttgac
gactacgaccgcaaacgcttccagcaacacgactttccgatggtggccttagagaagatg
caggtgttttccagctcggggctcaatggcactgacaggctgcccctggtgccgtctaag
tactcgatgacagtgatgatcttcgtcatgatgctgagcttttactacttctcccgccac
gtggaaaagctggcacggacactgttcttgtggaagattgaggtccacgaccagaaggaa
cgtgtctatgagatgcgacgctggaatgaagccttggtcaccaacatgctgcctgaacac
gtggcacgccatttcctggggtccaagaagagagatgaggagctgtacagccagtcttat
gatgagattggagttatgtttgcctccctgcccaattttgctgacttctacacagaggag
agcatcaataacggtggcattgagtgtctacgcttcctcaatgagatcatctcagatttt
gactctcttctggacaatcccaagttccgggtcatcaccaagatcaagaccattggtagc
acctacatggcagcttcaggagtcaccccagatgtcaacaccaatggctttaccagctcc
aacaaggacgagaagtcagacaaggagcgctggcagcacctggcagatctggccgatttt
gcgctggccatgaaggacacgctcaccaacatcaacaaccagtccttcaacaacttcatg
ctgcgcattggaatgaacaaaggaggggtcctggctggggtcattggagcccggaaacca
cactatgacatctggggcaacacagtcaacgtagccagcaggatggagtccacaggggtc
atgggcaacatccaggtggtggaagaaacccaagtcatccttcgagaatacggcttccgc
ttcgtgaggagagggcccatctttgtgaaagggaagggggaactgctaacctttttcttg
aagggccgagacaagctggccacattccctaacggcgcctcaatcacactgcctcaccag
gtggtagacaactcctga

DBGET integrated database retrieval system