KEGG   Bos mutus (wild yak): 102283124Help
Entry
102283124         CDS       T02919                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bom  Bos mutus (wild yak)
Pathway
bom04068  FoxO signaling pathway
bom04146  Peroxisome
bom04211  Longevity regulating pathway
bom04213  Longevity regulating pathway - multiple species
bom05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102283124 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102283124 (SOD2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    102283124 (SOD2)
   04213 Longevity regulating pathway - multiple species
    102283124 (SOD2)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05016 Huntington disease
    102283124 (SOD2)
Enzymes [BR:bom01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     102283124 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 102283124
NCBI-ProteinID: XP_014335155
LinkDB All DBs
Position
Un
AA seq 176 aa AA seqDB search
MQLHHSKHHAAYVNNLNVAEEKYREALEKGDVTAQIALQPALKFNGGGHINHSIFWTNLS
PNGGGEPQGELLEAIKRDFGSFAKFKEKLTAVSVGVQGSGWGWLGFNKEQGRLQIAACSN
QDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTARYTACSK
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgcaccacagcaagcaccacgcggcctacgtgaacaacctcaacgtcgccgag
gagaagtaccgggaggcgctggagaagggtgatgttacagctcagatagctctgcagcct
gcgttgaagttcaacggtgggggccatatcaatcacagcatcttctggacaaatctgagc
cctaacggtggtggagaaccccaaggggaattgctggaagccatcaaacgtgactttggt
tcctttgccaaatttaaggaaaagttgactgctgtatctgttggtgtccaaggctccggt
tggggttggctcggcttcaataaggagcagggacgcttacagattgctgcttgttctaac
caggatcccctgcaaggaacaacaggtcttatccccctgctggggattgacgtgtgggag
catgcttattaccttcagtataaaaatgtcaggcccgattatctgaaggccatttggaat
gtgatcaactgggagaatgtaactgcacgatacacggcttgcagcaagtaa

DBGET integrated database retrieval system