KEGG   Bos mutus (wild yak): 102283508
Entry
102283508         CDS       T02919                                 

Gene name
STAT1
Definition
(RefSeq) signal transducer and activator of transcription 1
  KO
K11220  signal transducer and activator of transcription 1
Organism
bom  Bos mutus (wild yak)
Pathway
bom04062  Chemokine signaling pathway
bom04217  Necroptosis
bom04380  Osteoclast differentiation
bom04620  Toll-like receptor signaling pathway
bom04621  NOD-like receptor signaling pathway
bom04625  C-type lectin receptor signaling pathway
bom04630  JAK-STAT signaling pathway
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom04917  Prolactin signaling pathway
bom04919  Thyroid hormone signaling pathway
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom04935  Growth hormone synthesis, secretion and action
bom05140  Leishmaniasis
bom05145  Toxoplasmosis
bom05152  Tuberculosis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
bom05212  Pancreatic cancer
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bom05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102283508 (STAT1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102283508 (STAT1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102283508 (STAT1)
   04621 NOD-like receptor signaling pathway
    102283508 (STAT1)
   04625 C-type lectin receptor signaling pathway
    102283508 (STAT1)
   04658 Th1 and Th2 cell differentiation
    102283508 (STAT1)
   04659 Th17 cell differentiation
    102283508 (STAT1)
   04062 Chemokine signaling pathway
    102283508 (STAT1)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102283508 (STAT1)
   04935 Growth hormone synthesis, secretion and action
    102283508 (STAT1)
   04919 Thyroid hormone signaling pathway
    102283508 (STAT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102283508 (STAT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102283508 (STAT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102283508 (STAT1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102283508 (STAT1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102283508 (STAT1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102283508 (STAT1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102283508 (STAT1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102283508 (STAT1)
   05160 Hepatitis C
    102283508 (STAT1)
   05171 Coronavirus disease - COVID-19
    102283508 (STAT1)
   05164 Influenza A
    102283508 (STAT1)
   05162 Measles
    102283508 (STAT1)
   05168 Herpes simplex virus 1 infection
    102283508 (STAT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102283508 (STAT1)
   05169 Epstein-Barr virus infection
    102283508 (STAT1)
   05165 Human papillomavirus infection
    102283508 (STAT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102283508 (STAT1)
   05140 Leishmaniasis
    102283508 (STAT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bom03000]
    102283508 (STAT1)
Transcription factors [BR:bom03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    102283508 (STAT1)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind STAT1_TAZ2bind SH2 TRPM_tetra NPV_P10
Other DBs
NCBI-GeneID: 102283508
NCBI-ProteinID: XP_005903038
LinkDB
Position
Un
AA seq 747 aa
MSQWYELQQLESKYLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIICNCLKEERKILDHAQ
RISQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMSIEHEIKTLEDLQDEYDFKCKTLQNR
EHETNGVAKNDQKQEQLLLQKMYLMLDNKRKEVVLKIIELLNATELTQKALINDELVEWK
RRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQA
LWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGARTN
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAE
PRNLSFFLNPPCARWSQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNAGPDGLIPWT
RFCKENINDKNFPFWLWIESILELIKKHLLALWNDGCIVGFISKERERALLKDQQPGTFL
LRFSESCREGAITFTWVERSQNGGEPYFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKFLYPNIDKDHAFGKYYSRPKEEPMELDGPKGTGYIKTELISVSEVHPSRLQTTDN
LLPMSPEEFDEVSRMVGSVEFDMMNAV
NT seq 2244 nt   +upstreamnt  +downstreamnt
atgtcccagtggtatgagcttcagcagcttgagtccaaatacctggagcaggttcaccag
ctctatgacgacagttttcccatggaaatcagacaatatctggcacagtggctagaaaag
caagactgggagcatgctgccaacgatgtttcatttgccaccatccgttttcatgacctg
ctatcgcagctggatgatcaatacagtcgcttttctttggagaataattttttattgcaa
cataacataaggaaaagcaagcgtaaccttcaggataattttcaggaagacccaatacag
atgtctatgatcatctgtaactgtctgaaggaggaaagaaagatcttggatcatgcccag
agaatcagccaggcgcagtctgggaatatccagagcactgtaatgttagacaaacagaag
gagcttgacagcaaagtcagaaatgtgaaagacaaagttatgagtattgagcatgaaatc
aagactctagaagacttgcaagatgaatatgactttaaatgcaaaaccttgcagaacaga
gaacatgaaaccaatggtgtggcaaagaatgatcagaaacaagaacagttgttactccag
aagatgtacttaatgctggacaataagagaaaggaagtcgttctcaaaataatagagttg
ttgaatgccactgaacttacccagaaagccctgattaatgatgaactggtggagtggaag
cggagacagcagagtgcctgtattggggggccccccaacgcttgcctggatcagctgcaa
aattggttcaccatagtggcggagagtctgcagcaggttcgtcagcagcttaaaaagctt
gaggagttggaacagaaatacacctatgaacatgaccccatcaccaaaaacaagcaagcc
ttatgggaccgcaccttcagcctcttccagcagctcattcagagctcatttgtggtggaa
agacagccctgcatgccaactcaccctcagaggccattggtcttgaagactggagtccag
ttcactgtgaagctgaggttgctggtgaagttgcaagagctgaattataacttgaaagtc
aaagtcttatttgacaaagatgtgaatgagagaaatacagtaaaagggtttaggaagttc
aacattctgggcactcacacgaaggtgatgaacatggaagagtccaccaacgggagtctg
gcggcagaattccgacacctgcaactgaaagaacaaaaaaatgccggtgccagaactaat
gagggtcctctcatcgtcactgaagagcttcactcccttagttttgaaacccagttgtgc
cagcctggtttggtcattgaccttgagacgacctctctacccgtcgtggtgatctccaat
gtcagccagctcccaagtggctgggcctctatcctgtggtacaacatgctggtggcagaa
ccccggaatctgtccttcttcctgaacccaccttgtgcacgatggtctcagctttcagag
gtgctgagttggcagttttcttctgtcaccaaaagaggtctcaatgtggaccagctgaac
atgctgggggagaagcttcttggccccaacgccggccccgatggtctgattccatggaca
aggttctgtaaggaaaatataaatgataaaaattttccgttctggctttggatcgaaagc
atccttgaactcattaaaaaacacctgcttgctctctggaatgatgggtgtatcgtgggc
tttattagcaaggagcgagagcgagccctgctgaaggaccaacagcctgggacgttcctg
ctgcgcttcagcgagagctgccgggaaggggcgatcacgttcacgtgggtggaacggtcc
caaaatggaggtgaaccttacttccacgcggttgaaccctacacaaagaaagaactttct
gcggttacttttcctgacattattcgtaattataaagtcatggctgctgaaaatattcca
gagaatcccctgaagtttctgtatccaaatattgataaagaccatgcctttggaaaatac
tactcccggccaaaggaagagcctatggaacttgatggccctaaaggaacaggatacatc
aagactgaattgatttctgtgtctgaagttcacccttctcgacttcagaccacagacaac
cttcttcccatgtctcctgaggagtttgacgaggtgtctcggatggtgggctctgtagaa
ttcgatatgatgaatgcggtctag

DBGET integrated database retrieval system