KEGG   Bos mutus (wild yak): 102283657
Entry
102283657         CDS       T02919                                 

Gene name
CISH
Definition
(RefSeq) cytokine inducible SH2 containing protein
  KO
K04701  cytokine inducible SH2-containing protein
Organism
bom  Bos mutus (wild yak)
Pathway
bom04630  JAK-STAT signaling pathway
bom04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102283657 (CISH)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102283657 (CISH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bom04121]
    102283657 (CISH)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:bom04990]
    102283657 (CISH)
Ubiquitin system [BR:bom04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     102283657 (CISH)
Domain-containing proteins not elsewhere classified [BR:bom04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   102283657 (CISH)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 102283657
NCBI-ProteinID: XP_005891516
UniProt: L8IW98
LinkDB
Position
Un
AA seq 254 aa
MVLCVQGLCPLLAVEQIGQRPLWAQSLELPQQVMQPLSAGAFLEEAVEESPAQPEREPKV
VDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSV
KTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCAADTRSDSPDLAT
TPALPTPKEDAPSDPALPATAVHLKLVQPFVRRSSTRSLQHLCRLVINRLVADVDCLPLP
RRMADYLRQYPFQL
NT seq 765 nt   +upstreamnt  +downstreamnt
atggtcctctgcgttcagggactttgtcctttgctggccgtggagcagattgggcagagg
cccctgtgggcccagtccctggagctgccccagcaagttatgcagcctttgtctgctggc
gccttcctggaggaggcagtagaggagtccccagcccagccagagagggagcccaaggtg
gtggaccccgaggaggacctgctgtgcatagccaagaccttctcctaccttcgggaatct
ggctggtactggggttccattacggccagtgaggcccggcaacaccttcagaagatgcca
gagggcaccttcctggtacgtgacagcacccaccccagctacctgttcacactgtccgtc
aagaccacccgcgggcccaccaacgtgcgcattgagtacgccgactccagcttccgcctg
gactccaactgcctgtccaggccgcgcatcctggccttcccagatgtggtgagcctggtc
cagcactatgtggcctcctgtgctgcagacacccggagtgacagtcccgaccttgccacc
accccggccctgcccaccccgaaggaagatgcgcccagtgacccagccctgcccgccacg
gccgttcacctgaagctggtacagccctttgtgcgcaggagcagcacccggagcctgcag
cacctgtgccgcctcgtcatcaaccgcctggtggccgacgtggactgcctgccgcttccc
cggcgcatggctgactacctccgacaataccccttccagctctga

DBGET integrated database retrieval system