KEGG   Bos mutus (wild yak): 102284187
Entry
102284187         CDS       T02919                                 

Gene name
KITLG
Definition
(RefSeq) KIT ligand
  KO
K05461  KIT ligand
Organism
bom  Bos mutus (wild yak)
Pathway
bom04010  MAPK signaling pathway
bom04014  Ras signaling pathway
bom04015  Rap1 signaling pathway
bom04072  Phospholipase D signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04640  Hematopoietic cell lineage
bom04916  Melanogenesis
bom05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102284187 (KITLG)
   04014 Ras signaling pathway
    102284187 (KITLG)
   04015 Rap1 signaling pathway
    102284187 (KITLG)
   04072 Phospholipase D signaling pathway
    102284187 (KITLG)
   04151 PI3K-Akt signaling pathway
    102284187 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102284187 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    102284187 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102284187 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102284187 (KITLG)
Cytokines and growth factors [BR:bom04052]
 Growth factors
  Growth factors (RTK binding)
   102284187 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 102284187
NCBI-ProteinID: XP_005906392
LinkDB
Position
Un
AA seq 314 aa
MPEDHSLVSSRHGSEGGYLEGPWSLPGKTDGAGDKWYCSEMRRRETWIITCIYLQLLLFN
PLVHTQGICSNRVTDDVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISQMVEQLSVS
LTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECMEEHSFENVKKSSKSPEPRQFTPEKF
FGIFNKSIDAFKDLEIVASKMSECVISSTSSPEKDSRVSVTKPFMLPPVAASSLRNDSSS
SNRKASNSIEDSSLQWAAVALPAFFSLVIGFAFGAFYWKKKQPNLTRTVENRQINEEDNE
ISMLQEKEREFQEV
NT seq 945 nt   +upstreamnt  +downstreamnt
atgcctgaagaccacagtcttgtgagtagcaggcatggaagcgaaggaggctatttagaa
ggtccttggagtcttcccggcaagactgatggagctggggacaagtggtactgctccgag
atgagacggagggaaacttggattatcacttgcatttatcttcaactgctcctatttaat
cctctcgtccacactcaagggatctgcagtaaccgtgtgactgatgatgtgaaagacgtt
acaaaattggtggcaaatcttcccaaagactatatgataaccctcaaatatgtccccggg
atggacgttttgcctagtcattgttggataagccagatggtggaacaactgtcagtcagc
ttgactgatcttctggacaagttttcaaatatttctgaaggcttgagtaattattctatt
atagacaaacttgtgaaaatagttgatgaccttgtggagtgcatggaagaacactcattt
gagaatgtaaaaaaatcatctaagagcccagaacccaggcagtttactcctgagaaattt
tttggaatttttaataaatccatcgatgccttcaaggacttggagatagtggcttctaaa
atgagtgaatgtgtgatttcctcaacatcaagtcctgaaaaagattccagagtcagtgtc
acaaaaccatttatgttaccccctgttgcagccagctcccttaggaatgacagcagtagc
agtaataggaaggcctcaaattccattgaagattccagcctacaatgggcagccgtagca
ttgccagcattcttttctcttgtgatcgggtttgcttttggggccttttactggaagaag
aaacaaccaaatcttacaaggacagttgaaaacagacagattaatgaagaggataatgaa
ataagtatgttgcaagagaaagagagagagtttcaagaagtgtaa

DBGET integrated database retrieval system