KEGG   Bos mutus (wild yak): 102284256
Entry
102284256         CDS       T02919                                 

Gene name
RALGDS
Definition
(RefSeq) ral guanine nucleotide dissociation stimulator
  KO
K08732  ral guanine nucleotide dissociation stimulator
Organism
bom  Bos mutus (wild yak)
Pathway
bom04014  Ras signaling pathway
bom04015  Rap1 signaling pathway
bom04072  Phospholipase D signaling pathway
bom05200  Pathways in cancer
bom05210  Colorectal cancer
bom05212  Pancreatic cancer
bom05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102284256 (RALGDS)
   04015 Rap1 signaling pathway
    102284256 (RALGDS)
   04072 Phospholipase D signaling pathway
    102284256 (RALGDS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102284256 (RALGDS)
   05231 Choline metabolism in cancer
    102284256 (RALGDS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102284256 (RALGDS)
   05212 Pancreatic cancer
    102284256 (RALGDS)
SSDB
Motif
Pfam: RasGEF RasGEF_N RA
Other DBs
NCBI-GeneID: 102284256
NCBI-ProteinID: XP_005902817
LinkDB
Position
Un
AA seq 1361 aa
MPPYPDYPAHTGLSREGESTQSARLRSSVSSPSCLSFPIYSPIYPCISVLTIQCVNYATY
GALGWEAQGLASSVLELAPALGASLLPGAEGVCPPPELGEAPVVPEPVGLGKAQGLFWYH
RTVQMCPPDCLELGLVLQAPDLQHSTIPPYHKPLIFKRVGELTSSRGSKVLGARPAHTGT
PLLEKKCGKEDSRHPPPPPGSHLELQEAFLVIFPEQSRDSDGVGHVVTQGRQGTKAPLPS
PDAAARGPLLCSSPAWAWSSSQRNGLNGSEARLTCAEGPARACPGLLPNKIEHSGEPCYA
SLSSGRLSVSVCSRAKAAGEKEQGPEGRAEVPSLRAVDQYLPSDQRRPRSMDKLSSTKSV
PHTKKLGASALEKPRCRGCPVQGILPAMKEILLPQQCGGSGTGGLMCLRAGSGAPVHPPL
LSVPTILCAQPAACQGPRRSPTSWPKTPLPAPATENWLKEFGWKLPGEAPSPIVDPLGTP
RCPEEEAVPGSSQEPGAEEVARCANSSHTQPSGRAQRPGWIQLSISLWEMVKDMEVGGPD
SCPVVLNSFTQLDPDLPRLESSTQEIGEELVNGVIYSISLRKIQVHHGASKGQRWLGYEN
ESALNLYETCKVRTVKAGTLEKLVEHLVPAFQGSDLSYVTIFLCTYRAFTTTQQVLDLLF
KRYGCILPYSSEDGGPQDQLKKSISSILGTWLDQYSEDFCQPPDFPCLRQLVAYVQLNMP
GSDLERRAHLLLAQLEHADLSEAEPEALSPAPVPALKPAAEPEPTLGPDLEPAPALAPEP
ALMPAPTLPPELEPALSQTLELEPPAAPDPPWPLPVATENGLGEEKPHLLAFPPDLVAEQ
FTLMDAELFKKVVPYHCLGSIWSQRDKKGKEHLAPTVRATVAQFNSVANCVITTCLGDRS
VSARHRARVVEHWIEVARECRVLKNFSSLYAILSALQSNSIHRLKKTWEEVSRDSLRVFQ
KLSEIFSDENNYSLSRELLIKEGTSKFATLEMNPKRAQRRPKEAGVIQGTVPYLGTFLTD
LVMLDTAMKDYLYGRLINFEKRRKEFEVIAQIKLLQSACNNYSITPEEHFGAWFRAMERL
SEAESYTLSCELEPPSESASNTLKVKKNTAIVKRWSDRQAPSAELSTSGSCHSQSCDQLR
YGPYLSSGDIADALSVHSAGSSSSDVEEINMSFVPESPDGQEKKFWESASQSSPETSGIS
SASSSTSSSSASTTPVASTRTHKRSVSGVCSYGSSLPLYNQQVGDSCIIRVSLDVDNGNM
YKSILVTSQDKAPAVIRKAMDKHNLDEDEPEDYELVQVISDDRKLKIPDNANVFYAMNST
ANYDFVLKKRTFTKGTKVRHGASSTLPRMKQKGLKIAKGIF
NT seq 4086 nt   +upstreamnt  +downstreamnt
atgcccccctaccccgactaccccgcccacaccggactcagccgggagggagagtccacg
cagagcgcgcgcttacgcagttccgtgtccagcccttcctgcctcagtttccccatctat
agccccatctacccttgtatctctgtgttaaccattcagtgcgtcaattatgccacttat
ggggccctggggtgggaggctcagggcttagcctcgagtgtcctggaactggcaccagcc
ctgggagcctcgctgctccctggtgcggagggggtgtgcccacctccggagttgggggag
gctccggtggtacccgaaccggttggcttggggaaggcacagggcctcttctggtaccac
cggaccgtccagatgtgcccacctgactgtttggagctggggctggtgctccaggcccct
gacctccagcactccaccatcccaccctatcacaagcctctcatctttaaacgggtaggc
gagcttaccagctcacggggctctaaggtgctcggcgcacgcccggctcacactggaact
ccgttgctggagaagaagtgtgggaaggaggacagcaggcaccccccaccacctcctggc
agccatctggagctccaggaagctttcctggtcatcttcccagaacaaagccgtgacagt
gatggggtgggccatgtggtgacacaaggccggcagggaacaaaggcgcctctgccgtcc
cccgacgcggcggctcggggcccactgctctgcagcagccctgcctgggcctggtctagc
tcgcagaggaatggcctaaatggctccgaagccaggttgacctgtgcagaaggtcctgct
agggcctgcccagggcttctccccaacaagattgagcactcaggggagccctgctatgcc
agcctgtcctcaggaagattaagtgtctctgtgtgcagtagggccaaggcggctggggag
aaggagcaggggccggaggggagagcagaggtccccagcctccgggctgtggaccagtac
ctcccatcagatcagcggcggcctcggtccatggacaaactgtcttccacgaaatcagtc
cctcataccaaaaagttgggggcctctgccctagagaagccccgctgcagaggctgcccc
gtccagggcatccttcctgccatgaaagaaattctcctgccccagcagtgtgggggcagt
ggaaccgggggcctgatgtgcctgcgggctggctccggagccccggtccaccctcctctc
ctctcggtccccacgatcctgtgtgcccagccggccgcctgccagggcccaagaaggagc
cccacatcttggccgaagacgcctctgccggcacccgccactgagaactggttgaaggag
tttggctggaaattgcctggagaggctccatctcccattgtggatcccctggggactccc
cgttgccctgaggaggaggccgtccctggaagttcccaggaaccaggggcggaggaggtg
gcccgctgtgccaacagctcccacactcagcccagtggtcgtgcgcagaggcctggctgg
attcagctgagcatctccctctgggagatggtgaaggacatggaagtgggcggccccgac
agctgcccggtggtgctgaacagcttcacgcagctcgaccctgacctgccgcgcctggag
agctccacgcaggagatcggcgaggagctggtcaacggggtcatctactccatttccctg
cgcaagatccaggtgcaccacggcgccagcaagggccagcgctggctcgggtatgaaaac
gagtcggccctgaacctgtacgagacctgcaaggtgcggactgtgaaggcgggcacgctg
gagaagctggtggagcacctggtgcccgccttccagggcagcgacctctcctacgtcacc
atcttcctgtgcacctaccgagccttcaccaccacccagcaggtcctggacctgctgttc
aagagatatgggtgcatccttccctactccagcgaggacggcggaccccaggaccaactc
aaaaagtccatctcctccatcctgggcacctggctggaccagtactcggaggacttctgt
cagccccccgacttcccctgcctcaggcagctggtggcctacgtgcagctcaacatgccc
ggctccgacctggagcgccgggcccacctcctcctggcccagctggagcacgcggacctc
agcgaggcagagccggaggctctgtccccagctccagttccagctctgaaaccagctgcc
gagccagagcccacactaggcccagacctcgagcccgctccggcactggccccagagcca
gccctgatgccagctccgacgctgcctccagagctcgagccggctctctcgcaaacccta
gagctcgagccgcctgcagccccagaccccccctggcctttgcccgtggctacagagaat
gggctgggggaggagaagccccacctcctggcattccctcctgaccttgtggcagagcag
ttcacgctcatggatgcggagctgttcaagaaagtggtcccctaccactgcctgggctcc
atctggtcccagcgggacaagaagggcaaggagcacctggcccccaccgtgcgtgccacc
gtcgcccagttcaacagcgtggccaactgcgtcatcaccacctgcctcggggaccggagc
gtgtcagcccgccacagggccagggtggtggagcactggatcgaggtggccagggagtgc
cgggtcctcaagaacttctcctccctctacgccatcctctctgccctgcagagcaactcc
atccaccggctgaagaagacgtgggaagaggtctccagggacagcctccgcgtctttcag
aagctgtcggagattttctcggacgagaacaactactccctaagcagagagctgctcatc
aaggaggggacctccaagtttgccaccctggagatgaaccccaagcgagcccagaggcgc
ccgaaagaggcgggtgtcatccagggcaccgttccctacctgggcacattcctcacggac
ctggtgatgctggacactgccatgaaggactatctgtatgggagactgatcaacttcgag
aagaggaggaaggaattcgaagtgatcgcccagatcaagctgctccagtcagcctgcaac
aattacagcatcacgcccgaagagcacttcggggcctggttccgggccatggagaggctc
agcgaggctgagagctacacattgtcgtgcgagctggagcccccctccgagtcggccagc
aacaccctcaaggtcaagaagaacacggccatcgtcaagcgctggagcgaccgccaggcc
cccagcgcagagctcagtaccagcggcagctgccactcccagtcctgtgaccaactcagg
tacggcccctacctcagcagcggagacattgctgacgcactcagcgtccactcggccggc
tcctctagctccgacgtggaggagatcaacatgagcttcgtcccagagtcccccgacggc
caggagaagaagttctgggagtcagcctcccagtcgtccccggagacctccggcatcagc
tcggcctccagcagcacgtcctcctcctcggcctccaccacgcccgtggccagcacgcgc
acccacaagcgctccgtgtccggggtctgcagctatggctcctcgctgcccctctacaac
cagcaggtcggcgactcctgcatcatccgggtgagcctggacgtggacaacggcaatatg
tacaagagcatcctggtgaccagccaagacaaggctccggctgtaatccgcaaggccatg
gacaaacacaacctggatgaggacgagcccgaagactacgagctggtgcaggttatttcg
gatgatcgaaagctgaagatccctgacaacgccaacgtgttctacgccatgaactctacc
gccaactatgactttgtcctaaagaaacggaccttcaccaaggggacaaaggtcagacat
ggagccagctcgaccctcccccgcatgaagcagaagggactcaagattgccaagggcatc
ttctaa

DBGET integrated database retrieval system