KEGG   Bos mutus (wild yak): 102284346Help
Entry
102284346         CDS       T02919                                 

Gene name
GANC
Definition
(RefSeq) glucosidase alpha, neutral C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00052  Galactose metabolism
bom00500  Starch and sucrose metabolism
bom01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102284346 (GANC)
   00500 Starch and sucrose metabolism
    102284346 (GANC)
Enzymes [BR:bom01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102284346 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110 Zfx_Zfy_act
Motif
Other DBs
NCBI-GeneID: 102284346
NCBI-ProteinID: XP_005904043
UniProt: L8I4C1
LinkDB All DBs
Position
Un
AA seq 914 aa AA seqDB search
MESAEKEEISVEDEAVDKNVFKDCSKISFYRRQKQLLSKKSTYRALLDSVTPGEDSARFQ
IINEPAKVPLLAEVCGIEGNIFRLKINEEIPLKPRYEVPDVLTSKLTTVRLTSCPGDTGS
LVLASRKGDLKCHITANPFKVDLVSEEEVVMSINSLGQLYFEQLQIPPKQRATKKNEEDA
SIDTTQENQEELGLWEEKFENFVDVKVNGPASIGLDFSLHGFEHLYGIPQHAESHQLKNT
SDSDAYRLYNLDVYGYKIHDKMGIYGSVPYLLAHKLGRTLGIFWLNASETLVEIKTEPAV
KYTLTQTGPVAAKQKVGSRTDVHWMSESGIIDVFLLTGPTPSDVFKQYSYLTGTQAMPPL
FSLGYHQCRWNYEDEQDVKAVDAGFDEHDIPYDVMWLDIEHTEGKRYFTWDKKRFPNPKR
MQDLLRSKKRKLVVISDPHIKVDPNYSVYAKAKEQGFFVRNHEGGDFEGVCWPGLSSYLD
FTNPKVRKWYSSLFAFSVYQGSTDILHIWNDMNEPSVFKGPEQTMQKNAIHHGNWEHREL
HNIYGFYQQMATTEGLIQRSKGKERPFVLTRSFFAGSQKYGAVWTGDNTAEWSHLKISIP
MLLTLSVTGISFCGADVGGFIGDPEAELLVRWYQAGAYQPFFRGHATMNTKRREPWLFGE
EHTRLIREAIRERYTLLPYWYSLFYSAHVASQPVMRPLWVEFPNELETFSVEDEYMLGGA
LLVHPVTEPKATVVDVFLPGSSEIWYDSKTFAHWKGACTVKIPVTLDAIPVFQRGGSVVP
IKTTIGRSTGFMTDSPYGLRVALSTKGSAMGEFYLDDGHSFQYLHQKQFLHRKFSFSSGV
LTNSCADERGHYPSKCVVEQILVLGLKKQPSSVTVHSADGSAQPVAFTYHATTSTLKLET
LSLNIGADWKVRVQ
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggaatcagctgagaaagaggaaatcagtgttgaagatgaagctgtggataaaaacgtt
ttcaaagactgcagcaagatttcgttctacaggcgtcagaaacagctgctctccaagaag
tctacctatcgggcattactggactcggtcacaccaggcgaagacagtgccaggttccaa
atcatcaacgaaccagcaaaggttccactcctggctgaagtttgtggcatagagggaaat
attttcagacttaaaatcaatgaagaaatacccttgaaacccaggtatgaagttcctgat
gtcctcacaagcaagctaaccactgtaaggctgacttcttgcccaggggatacaggcagt
ctggtgttggcaagtagaaaaggagatctgaagtgtcacatcacggcaaacccattcaag
gttgacttggtatctgaagaagaggttgtaatgagcataaactccctgggccaattgtac
tttgagcagctgcagattcctcccaagcaaagagctaccaagaaaaatgaggaggatgca
tcaattgacaccactcaggaaaatcaagaggaactgggcctctgggaggagaaatttgaa
aattttgtggatgtcaaagttaatggtcctgcctccattggtttggatttctctttgcat
ggttttgagcatctctatggaattccgcaacatgctgaatcacaccaacttaaaaacaca
agtgatagtgatgcttaccgtctttataacctggatgtctatggatataaaatacatgac
aaaatgggcatttatggttcagtgccttatctcctggcccacaaactgggcagaactcta
ggcattttttggctaaatgcctcagaaacactagtggagatcaaaacagaacctgctgta
aagtacacactgacccagacgggcccagttgctgctaaacaaaaggtcgggtctcgaact
gatgtgcactggatgtcagagagtgggatcattgatgtttttctgttgacaggacctact
ccttctgatgtcttcaagcagtattcataccttacaggcacacaagccatgccccctctc
ttttctctggggtaccatcagtgccgctggaactatgaagatgagcaggatgtaaaggca
gtggatgccggatttgatgaacatgacattccttatgatgtcatgtggctggacatagag
cacacagagggcaagaggtacttcacctgggacaagaaaagattcccaaaccccaaaagg
atgcaagatctgctcaggagcaaaaaacgtaagcttgtggtcattagtgacccccacatc
aaggttgatcccaactactcagtgtatgctaaggccaaagaacagggcttctttgtgagg
aatcatgaaggaggagactttgaaggtgtatgctggcctggtctctcctcttacctggat
ttcaccaaccccaaagtcagaaagtggtattctagtcttttcgctttctctgtttatcag
ggatctactgacatcctccacatatggaacgacatgaatgagccctctgtctttaaaggc
ccagagcaaaccatgcagaagaatgccattcatcacggcaactgggagcaccgggaactt
cacaacatctatggcttttatcagcaaatggccactacagaaggactgatccagcgatct
aaaggaaaggagagaccctttgttcttacacgttcattctttgctggatcacaaaaatat
ggtgctgtgtggacaggtgataacacggcagagtggagtcacctgaaaatttctatccct
atgttacttaccctcagcgtgactgggatctctttttgtggagcggatgtaggtggcttc
atcggggatccagaggcagagctgctagtgcggtggtaccaggcaggagcctaccagccc
ttcttccgtggccatgccaccatgaacaccaagcgacgggagccctggctctttggggag
gagcacacccggctcatccgagaagccatcagagagcgctacaccctcctgccctactgg
tattctctgttctactctgcacacgtggcttctcaacctgtcatgaggcctctgtgggta
gagttccctaatgaattagagacttttagtgtggaagatgaatacatgctgggaggtgct
ttattggttcatccagtcacagaaccaaaagctactgttgttgatgtgtttctgccaggg
tcaagtgagatttggtatgactctaagacatttgctcactggaaaggagcgtgtacagta
aagatcccagtaaccttggacgctataccagtgtttcaacgtggtggaagtgtggtacca
ataaagaccactataggaagatccacaggcttcatgactgattccccgtatggactccga
gtcgctctaagcactaagggttctgccatgggtgaattctatcttgatgatgggcattct
ttccaatacctccaccagaagcaattcttgcacaggaagttttcattttcctcaggtgtt
ttgaccaacagttgtgctgacgagaggggtcattatcccagcaagtgtgtggtggagcag
atcttggtcctaggcctcaagaagcagccatcttctgtgactgtccactcagctgatggc
agcgctcagcctgtggcttttacgtaccatgccacaacatccaccctaaagctggagacg
ctctcgctgaacattggtgcggactggaaggtgcgcgtccagtga

DBGET integrated database retrieval system