KEGG   Bos mutus (wild yak): 102284461
Entry
102284461         CDS       T02919                                 

Gene name
CDKN2A
Definition
(RefSeq) cyclin dependent kinase inhibitor 2A
  KO
K06621  cyclin-dependent kinase inhibitor 2A
Organism
bom  Bos mutus (wild yak)
Pathway
bom01522  Endocrine resistance
bom01524  Platinum drug resistance
bom04110  Cell cycle
bom04115  p53 signaling pathway
bom04218  Cellular senescence
bom04934  Cushing syndrome
bom05163  Human cytomegalovirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05200  Pathways in cancer
bom05203  Viral carcinogenesis
bom05206  MicroRNAs in cancer
bom05212  Pancreatic cancer
bom05214  Glioma
bom05218  Melanoma
bom05219  Bladder cancer
bom05220  Chronic myeloid leukemia
bom05223  Non-small cell lung cancer
bom05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:bom00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102284461 (CDKN2A)
   04115 p53 signaling pathway
    102284461 (CDKN2A)
   04218 Cellular senescence
    102284461 (CDKN2A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102284461 (CDKN2A)
   05206 MicroRNAs in cancer
    102284461 (CDKN2A)
   05203 Viral carcinogenesis
    102284461 (CDKN2A)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102284461 (CDKN2A)
   05225 Hepatocellular carcinoma
    102284461 (CDKN2A)
   05214 Glioma
    102284461 (CDKN2A)
   05220 Chronic myeloid leukemia
    102284461 (CDKN2A)
   05218 Melanoma
    102284461 (CDKN2A)
   05219 Bladder cancer
    102284461 (CDKN2A)
   05223 Non-small cell lung cancer
    102284461 (CDKN2A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102284461 (CDKN2A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102284461 (CDKN2A)
   05163 Human cytomegalovirus infection
    102284461 (CDKN2A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102284461 (CDKN2A)
   01522 Endocrine resistance
    102284461 (CDKN2A)
SSDB
Motif
Pfam: P19Arf_N
Other DBs
NCBI-GeneID: 102284461
NCBI-ProteinID: XP_014334766
LinkDB
Position
Un
AA seq 153 aa
MVRRFLITVRIRRANGPPRVRIFVVHIARAAGEWAAPSVRAAVALVLMASEEPAQSAAMH
PRPGDDDGQRPRGRAAAAPRRGPQLRGPRHPHPTGARRRPGGLPGHAGGPAPSWSAAGCA
RCLGPPARGPGGGAGPRRRRPVPARGCRGHGRR
NT seq 462 nt   +upstreamnt  +downstreamnt
atggtgcgccggttcttgattacagtgaggattcggcgcgcgaacggcccaccacgagtc
aggattttcgtggtgcacatcgcgcgggcagcgggtgagtgggcagcgccgagtgtgcgg
gccgctgtggccctcgtgctgatggctagtgaggagccagcgcagagcgcagcgatgcat
cctagaccaggtgatgatgatgggcagcgcccgcgtggccgagctgctgctgctccacgg
cgcggaccccaactgcgcggaccccgccaccctcacccgaccggtgcacgacgccgcccg
ggagggcttcctggacacgctggtggccctgcaccgagctggagcgcggctggatgtgcg
cgatgcttggggccgcctgcccgtggacctggcggaggagcggggccacggcgacgtcgc
ccggtacctgcgcgcggctgcagaggacacggaaggcggtag

DBGET integrated database retrieval system