KEGG   Bos mutus (wild yak): 102284506
Entry
102284506         CDS       T02919                                 

Gene name
SRC
Definition
(RefSeq) SRC proto-oncogene, non-receptor tyrosine kinase
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
bom  Bos mutus (wild yak)
Pathway
bom01521  EGFR tyrosine kinase inhibitor resistance
bom01522  Endocrine resistance
bom04012  ErbB signaling pathway
bom04015  Rap1 signaling pathway
bom04062  Chemokine signaling pathway
bom04137  Mitophagy - animal
bom04144  Endocytosis
bom04360  Axon guidance
bom04370  VEGF signaling pathway
bom04510  Focal adhesion
bom04520  Adherens junction
bom04530  Tight junction
bom04540  Gap junction
bom04611  Platelet activation
bom04625  C-type lectin receptor signaling pathway
bom04727  GABAergic synapse
bom04750  Inflammatory mediator regulation of TRP channels
bom04810  Regulation of actin cytoskeleton
bom04912  GnRH signaling pathway
bom04915  Estrogen signaling pathway
bom04917  Prolactin signaling pathway
bom04919  Thyroid hormone signaling pathway
bom04921  Oxytocin signaling pathway
bom04926  Relaxin signaling pathway
bom05100  Bacterial invasion of epithelial cells
bom05135  Yersinia infection
bom05152  Tuberculosis
bom05161  Hepatitis B
bom05163  Human cytomegalovirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05203  Viral carcinogenesis
bom05205  Proteoglycans in cancer
bom05219  Bladder cancer
bom05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102284506 (SRC)
   04015 Rap1 signaling pathway
    102284506 (SRC)
   04370 VEGF signaling pathway
    102284506 (SRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102284506 (SRC)
   04137 Mitophagy - animal
    102284506 (SRC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102284506 (SRC)
   04520 Adherens junction
    102284506 (SRC)
   04530 Tight junction
    102284506 (SRC)
   04540 Gap junction
    102284506 (SRC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102284506 (SRC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102284506 (SRC)
   04625 C-type lectin receptor signaling pathway
    102284506 (SRC)
   04062 Chemokine signaling pathway
    102284506 (SRC)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102284506 (SRC)
   04915 Estrogen signaling pathway
    102284506 (SRC)
   04917 Prolactin signaling pathway
    102284506 (SRC)
   04921 Oxytocin signaling pathway
    102284506 (SRC)
   04926 Relaxin signaling pathway
    102284506 (SRC)
   04919 Thyroid hormone signaling pathway
    102284506 (SRC)
  09156 Nervous system
   04727 GABAergic synapse
    102284506 (SRC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102284506 (SRC)
  09158 Development and regeneration
   04360 Axon guidance
    102284506 (SRC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102284506 (SRC)
   05203 Viral carcinogenesis
    102284506 (SRC)
  09162 Cancer: specific types
   05219 Bladder cancer
    102284506 (SRC)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102284506 (SRC)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102284506 (SRC)
   05152 Tuberculosis
    102284506 (SRC)
   05100 Bacterial invasion of epithelial cells
    102284506 (SRC)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102284506 (SRC)
   05168 Herpes simplex virus 1 infection
    102284506 (SRC)
   05163 Human cytomegalovirus infection
    102284506 (SRC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102284506 (SRC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102284506 (SRC)
   01522 Endocrine resistance
    102284506 (SRC)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102284506 (SRC)
Protein kinases [BR:bom01001]
 Non-receptor tyrosine kinases
  SRC family
   102284506 (SRC)
Membrane trafficking [BR:bom04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    102284506 (SRC)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    102284506 (SRC)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    102284506 (SRC)
  Macropinocytosis
   Kinases
    102284506 (SRC)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_10 SH3_3
Other DBs
NCBI-GeneID: 102284506
NCBI-ProteinID: XP_005896063
LinkDB
Position
Un
AA seq 542 aa
MGSNKSKPKDASQRRRSLESAENTHGGGGGGGGGGGAFPSSQTPSKPASSDGHRGPNTAF
APAAAEPKLFGGFNSSDTVTSPQRAGPLSGGVTTFVALYDYESRTETDLSFKKGERLQIV
NNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGT
FLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYS
KHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTR
VAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLK
GETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGESLVCKVADFGLARLI
EDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREV
LDQVERGYRMPCPPECPESLHDLMCQCWRKDPEERPTFEYLQAFLEDYFTSTEPQYQPGE
NL
NT seq 1629 nt   +upstreamnt  +downstreamnt
atgggcagcaacaagagcaagcccaaggatgccagccagcggcgccgcagcctggagtct
gccgagaacacccacggaggcggcggcggtggcggcggcggtgggggtgccttcccctcc
tcacagacccccagcaaaccagcctcctctgatggccaccgcggccccaacacggccttc
gcccctgcagccgctgagcccaagctgttcggaggcttcaactcctcggacacagtcacc
tccccgcagagggcggggcccctgtctggcggagtgaccaccttcgtggccctctatgac
tatgagtcgcggacagagactgacctgtctttcaagaaaggggagcggcttcagattgtc
aacaacacagagggagactggtggctggcccactcgctcagcacaggacagacgggctac
atccccagcaactacgtggcaccctctgactccatccaggctgaagagtggtactttggc
aagatcaccagacgggagtcagagcggttactgctcaatgcagagaacccaagagggacc
ttcctagtgcgagaaagcgagaccacgaaaggcgcctactgcctctcggtgtctgacttc
gacaacgccaagggcctcaacgtgaagcactacaaaatccgcaagctggacagcggaggc
ttctacatcacctcccgcacccagttcaacagcctgcagcagctggtggcctactactcc
aaacacgctgacggcctctgccaccgcctcaccactgtgtgccccacgtccaagccgcag
actcaaggcctggccaaagatgcctgggagatcccccgggagtcgctgcggctggaggtc
aagctgggccagggctgcttcggagaggtgtggatgggtacctggaacggcaccaccagg
gtggccatcaaaaccctgaagcctggtacgatgtctccggaggccttcctgcaggaggcc
caggttatgaagaaactgaggcatgaaaaactcgtgcagctgtacgccgtggtgtccgaa
gagcccatctacattgtcacggagtacatgagcaaggggagtttgctggactttctcaag
ggggagacaggcaagtacctgcggctgcctcagctggtggacatggctgcacagatcgcc
tcaggcatggcttatgtggaacggatgaactatgtccaccgagacctccgggctgccaac
atcctggttggagagagcctcgtatgcaaagtggctgacttcgggctggctcgactcatt
gaagacaacgaatacacagcccggcaaggtgccaaattccccatcaagtggacagctccg
gaagctgccctctatggccggttcaccatcaaatcagacgtgtggtcctttgggatcctg
ctgacggagctcacaacaaagggacgggtgccctaccctgggatggtgaaccgggaggtg
ctggaccaggtggagcggggctaccggatgccctgccctcctgagtgtcccgagtcattg
catgacctgatgtgccagtgctggcggaaggacccggaggaacggcccaccttcgagtac
ctgcaggccttcctggaggactatttcacgtccaccgagccccagtaccagcccggagag
aacctatag

DBGET integrated database retrieval system