KEGG   Bos mutus (wild yak): 102284602
Entry
102284602         CDS       T02919                                 

Gene name
DLG1
Definition
(RefSeq) discs large MAGUK scaffold protein 1
  KO
K12076  disks large protein 1
Organism
bom  Bos mutus (wild yak)
Pathway
bom04390  Hippo signaling pathway
bom04530  Tight junction
bom04660  T cell receptor signaling pathway
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    102284602 (DLG1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102284602 (DLG1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    102284602 (DLG1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102284602 (DLG1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102284602 (DLG1)
   05165 Human papillomavirus infection
    102284602 (DLG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bom03036]
    102284602 (DLG1)
Chromosome and associated proteins [BR:bom03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    102284602 (DLG1)
SSDB
Motif
Pfam: Guanylate_kin PDZ MAGUK_N_PEST L27_1 PDZ_6 PDZ_assoc PDZ_2 SH3_1 SH3_2 SH3_9
Other DBs
NCBI-GeneID: 102284602
NCBI-ProteinID: XP_005897888
UniProt: L8IHB4
LinkDB
Position
Un
AA seq 927 aa
MPVRKQDTQRALHLLEDYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTL
LDNPKCIDHSKQSEPIQPVNTWEISSLPSTTVTSETLPSSLSPSVEKYRYQDEDTPPQEH
ISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPVKPTEAVSPSSPTVPVIPVLP
VPAENTVILPIIPQANPPPVLVNTDSLETSTYVNGTDADYEYEEITLERGNSGLGFSIAG
GTDNPHIGDDSSIFITKIIAGGAAAQDGRLRVNDCILRVNEIDVRDVTHSKAVEALKEAG
SIVRLYVKRRKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAH
KDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMNDGYAPPDIT
NSSSQPIDNHVSPPSYLVQTPASPARYSPVSKAVLGDDEITREPRKVVLHRGSTGLGFNI
VGGEDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRTASHEQAAAALKNAGQAVT
IVAQYRPEEYSRFEAKIHDLREQMMNSSISSGSGSLRTSQKRSLYVRALFDYDKTKDSGL
PSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKTVKF
NSKARGDKGQSFNDKRKKNLFSRKFPFYKNKDQSEQETSDADQHVTSNASDSESSYRGQE
EYVLSYEPVNQQEVNYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDG
RDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKR
LQIAQLYPISIFIKPKSMENIMEMNKRLTEEQARKTFERAMKLEQEFTEHFTAIVQGDTL
EDIYNQVKQIIEEQSGPYIWVPAKEKL
NT seq 2784 nt   +upstreamnt  +downstreamnt
atgccggtccggaagcaagatacccagagagcattgcaccttttggaagattatcgttcg
aaactaagccaaacagaagacagacagctcagaagttccatagaacgggttattaacata
ttccagagcaacctctttcaggctttaatagatattcaagaattttatgaagtgacctta
ctggataatccaaaatgtatagatcattcaaagcagtctgaaccaatacagcctgtaaat
acttgggaaatttccagccttccaagcactactgtgacttcagaaacactgccaagcagc
cttagccctagtgtagagaaataccggtatcaggatgaagatacacctcctcaagagcac
atttctccacaaatcactaatgaggtgataggtccagaattggttcatgtctcagagaag
aacctgtcagaaattgaaaacgtccatggatttgtttctcactctcatatttcaccagta
aagccaacagaagctgtatctccctcttctcccactgtccctgtgatccctgtcctgcca
gtccctgctgagaatactgtcatcctacccatcataccacaggcaaatcctcctccagta
ctagtcaacacagacagcttggaaacatcaacttatgttaatggcactgatgcagattat
gaatatgaagaaatcacacttgaaaggggaaattcagggcttggtttcagcattgcagga
ggtacagacaacccacacattggagatgactcaagtattttcattactaaaattattgca
gggggagcagctgcccaagatggaagattgcgagtcaatgactgtattttgcgagtaaat
gaaatagatgttcgtgatgtaacacatagcaaagcagttgaagcattgaaagaagcagga
tctattgtacgcttgtatgtaaaaagacggaaaccagtatcagaaaaaataatggagata
aagctcattaaaggtcctaaaggtcttgggtttagcattgctggaggtgttggaaatcag
catattcctggggataatagcatctatgtaaccaaaataattgaaggaggagcagctcat
aaagatggtaaacttcagattggagataaacttttagcagtgaatagtgtgtgtttagaa
gaagttactcatgaagaagcagtaactgccttaaagaacacatctgattttgtttatttg
aaagtggcaaaacccacaagtatgtatatgaatgatggctatgcaccacctgatatcacc
aactcttcttctcagcctatcgataaccatgttagcccaccttcctacttggtccagaca
ccagcatcaccagccagatattcacctgtttctaaagcagtacttggagatgatgaaatt
acgagggaacctagaaaagttgttcttcatcgtggttcaacaggccttggtttcaacatt
gtaggaggtgaagatggagaaggaatatttatctcctttattttggctggaggacctgcc
gatcttagtggagagctcagaaaaggagatcgtattatatcggtaaacagtgttgacctc
agaactgccagccatgagcaggcagcagctgctttaaaaaatgctggccaagctgtcaca
attgttgcacagtaccgacctgaagaatacagtcgttttgaagccaaaatacatgactta
cgggagcagatgatgaatagtagcattagttcaggttcaggttctcttcgaactagccag
aagcgatccctctatgtcagggccctctttgattatgacaagactaaagacagtggcctt
cctagtcagggattgaacttcaaatttggagatatcctccatgttattaatgcttctgat
gatgaatggtggcaagccagacaggttacaccagatggtgaaagtgatgaagttggggtg
attcccagtaaacgcagggttgagaagaaagaacgagcccgattaaaaacagtgaaattc
aattctaaagcaagaggagataaagggcagtcattcaatgacaagcgtaaaaagaacctc
ttttcccgaaaattccccttctacaagaacaaggaccagagtgagcaggaaacaagtgat
gctgaccaacatgtaacttctaatgccagcgatagcgaaagtagttaccgtggtcaagaa
gaatatgtcttatcttatgaaccagtgaatcaacaagaagttaattatactcgaccagtg
atcatattgggacctatgaaagacaggataaatgatgacctgatctcagaatttcctgac
aaattcggatcatgtgttcctcatacaactagaccaaaacgagattatgaggtggatgga
agagattatcattttgtgacttcaagagaacaaatggaaaaagatatccaggaacataaa
ttcattgaagctggccagtataataaccatctgtatggaacaagtgttcagtctgtgcga
gaagtagcagaaaagggcaaacactgtatccttgatgtgtctggaaatgctataaagaga
ttacagattgcacaactttacccaatctccatttttattaaacccaaatccatggaaaat
atcatggaaatgaataagcgtctgacagaagaacaagccagaaagacatttgagagagcc
atgaaactggaacaagaatttactgaacatttcacagctattgtgcagggagatacgctg
gaagacatttacaaccaagtgaagcagatcatagaagaacagtctggtccttacatttgg
gttccagcaaaagaaaagttatga

DBGET integrated database retrieval system