KEGG   Bos mutus (wild yak): 102285300
Entry
102285300         CDS       T02919                                 

Gene name
PLCG2
Definition
(RefSeq) phospholipase C gamma 2
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00562  Inositol phosphate metabolism
bom01100  Metabolic pathways
bom01521  EGFR tyrosine kinase inhibitor resistance
bom04012  ErbB signaling pathway
bom04014  Ras signaling pathway
bom04020  Calcium signaling pathway
bom04062  Chemokine signaling pathway
bom04064  NF-kappa B signaling pathway
bom04066  HIF-1 signaling pathway
bom04070  Phosphatidylinositol signaling system
bom04072  Phospholipase D signaling pathway
bom04360  Axon guidance
bom04370  VEGF signaling pathway
bom04380  Osteoclast differentiation
bom04611  Platelet activation
bom04625  C-type lectin receptor signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom04662  B cell receptor signaling pathway
bom04664  Fc epsilon RI signaling pathway
bom04666  Fc gamma R-mediated phagocytosis
bom04670  Leukocyte transendothelial migration
bom04722  Neurotrophin signaling pathway
bom04750  Inflammatory mediator regulation of TRP channels
bom04919  Thyroid hormone signaling pathway
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom04935  Growth hormone synthesis, secretion and action
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
bom05205  Proteoglycans in cancer
bom05206  MicroRNAs in cancer
bom05214  Glioma
bom05223  Non-small cell lung cancer
bom05225  Hepatocellular carcinoma
Module
bom_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102285300 (PLCG2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102285300 (PLCG2)
   04014 Ras signaling pathway
    102285300 (PLCG2)
   04370 VEGF signaling pathway
    102285300 (PLCG2)
   04064 NF-kappa B signaling pathway
    102285300 (PLCG2)
   04066 HIF-1 signaling pathway
    102285300 (PLCG2)
   04020 Calcium signaling pathway
    102285300 (PLCG2)
   04070 Phosphatidylinositol signaling system
    102285300 (PLCG2)
   04072 Phospholipase D signaling pathway
    102285300 (PLCG2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102285300 (PLCG2)
   04625 C-type lectin receptor signaling pathway
    102285300 (PLCG2)
   04650 Natural killer cell mediated cytotoxicity
    102285300 (PLCG2)
   04662 B cell receptor signaling pathway
    102285300 (PLCG2)
   04664 Fc epsilon RI signaling pathway
    102285300 (PLCG2)
   04666 Fc gamma R-mediated phagocytosis
    102285300 (PLCG2)
   04670 Leukocyte transendothelial migration
    102285300 (PLCG2)
   04062 Chemokine signaling pathway
    102285300 (PLCG2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    102285300 (PLCG2)
   04919 Thyroid hormone signaling pathway
    102285300 (PLCG2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102285300 (PLCG2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102285300 (PLCG2)
  09158 Development and regeneration
   04360 Axon guidance
    102285300 (PLCG2)
   04380 Osteoclast differentiation
    102285300 (PLCG2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102285300 (PLCG2)
   05206 MicroRNAs in cancer
    102285300 (PLCG2)
   05205 Proteoglycans in cancer
    102285300 (PLCG2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102285300 (PLCG2)
   05214 Glioma
    102285300 (PLCG2)
   05223 Non-small cell lung cancer
    102285300 (PLCG2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102285300 (PLCG2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102285300 (PLCG2)
   05171 Coronavirus disease - COVID-19
    102285300 (PLCG2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102285300 (PLCG2)
   05169 Epstein-Barr virus infection
    102285300 (PLCG2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102285300 (PLCG2)
Enzymes [BR:bom01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     102285300 (PLCG2)
Membrane trafficking [BR:bom04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    102285300 (PLCG2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    102285300 (PLCG2)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 SH3_9 PH SH3_2 PH_12 PH_14 EF-hand_like GDPD
Other DBs
NCBI-GeneID: 102285300
NCBI-ProteinID: XP_005907337
LinkDB
Position
Un
AA seq 1221 aa
MAQALLETGRVFCWAPFFCWWNWEPAWGVLELHWRGLDRVAQPAGLQEAPLRWRMPSVIC
GWWLVDDGLSELLLPILDIMEIKEIRPGKSSKDFERAKAVRQKEECCFTVLYGSQFILST
LSLAADSKEDAAKWLSGLKILHQEVMSASTPTIIESWLRKQIYSVDQTRRNSISLRELKT
ILPLVNFKVSSAKFLKDKFLEIGAHKDELSFEQFHLFYKKLMFEQQKSILDEFKKDSSVF
LLGNTDRPDASAVHLHDFQRFLLHEQQELWAQDLNKVRERMTKFIDDTMRETAETFLFVD
EFLTYLFSRENSIWDEKYDVVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSTEAYIRC
LRMGCRCIELDCWDGPDGKPIIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEH
CCVEQQRHMARVFKEVFGDLLLTKPKEASADQLPSPSQLRGKIIIKHKKLGPRGDVDVNM
EDKKDEHKQQGELHMWDPIDQKWTRHYCAVADAKLSFSDDIEQTVEEELPLDIPPTELHF
GEKWFHKKVEKRTSAEKLLQEYCAETGGKDGTFLVRESETFPNDYTLSFWRSGRVQHCRI
RSTMEGGTMKYYLTDNLMFTSIYALIQHYRETHLRCAEFELRLTDPVPNPNPHESKPWYY
DGLSRGEAEDMLMRIPRDGAFLIRKREGTDSYAITFRARGKVKHCRINRDGRHFVLGTSA
YFESLVELVSYYEKHALYRKMKLRYPVTPELLERYNTERDINSLYDVSRMYVDPSEINPS
MPQRTVKALYDYRAKQSDELSFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDIS
PTEGEEVDKQIIEDNPLGSLCRGILNLNIYNVVKAPHGKNQKPFVFILEPKKQGDPPVEF
ATDSVEELFEWFQSIREITWKMDAKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLE
NPDFREIRSFVETKADSIVRQKPSDLLKYNQKGLTRVYPKGQRVDSSNYDPFRLWLCGSQ
MVALNFQTPDKYMQMNHALFSLNGRTGYVLQPESMRAEKYDPMPPESQRKIQMTLTVKVL
GARHLPKPGRSIACPFVEVEICGAEYDSNKFKTTVVNDNGLSPVWTPTQEKVTFEIYDPN
LAFLRFVVYEEDMFSDPNFLAHATYPIKGIKSGFRSVPLKNGYSEDIELASLLVFCEMRP
VLVSGETPVGARRATSAAEGG
NT seq 3666 nt   +upstreamnt  +downstreamnt
atggcccaggccctgctggagactgggagagtgttctgctgggctcccttcttctgctgg
tggaactgggagcctgcctggggagtgctggagctgcactggcggggcttggaccgggtc
gcccagcctgccgggctgcaggaggcccctctgaggtggcggatgccgagtgtcatctgt
ggctggtggctggtggacgatggcctgtcagagttgctgctgcctatattggacatcatg
gagataaaggagatccggccggggaagagctccaaggatttcgagcgcgcgaaagcggtc
cgccagaaggaagaatgctgcttcaccgtcctgtacggctcccagtttatcctcagcacg
ctcagcctggcagctgactcgaaggaggatgccgctaagtggctgtctggcctgaagatc
ttacaccaggaagtgatgagcgcgtccacccccaccatcatcgagagctggctgagaaag
cagatttattctgtggatcaaaccaggagaaacagcatcagcctccgggagttgaagacc
atcttgcctctggtcaacttcaaagtgagcagtgccaagttcctcaaagataagttcctg
gaaataggcgcacacaaagatgaactcagctttgaacagttccatctcttctataaaaaa
cttatgtttgaacagcaaaaatcgatccttgacgaattcaaaaaggattcctccgtgttc
ctcttgggcaacaccgaccggccagacgcctctgctgtccacctgcacgacttccagcgg
tttctcttgcatgaacagcaggagctttgggctcaggatctgaacaaagtccgtgagcgg
atgacgaagtttattgacgacaccatgagggaaactgctgaaaccttcctgtttgtggat
gagttcctcacgtacctgttttcccgggagaacagcatctgggacgaaaagtacgacgtg
gtggacatgcaggacatgaacaaccccttgtctcattactggatctcctcgtctcacaac
acgtacctcacgggggaccagctgcggagcgagtcgtccacggaggcctacatccgctgc
ctgcggatgggctgccgctgcatcgagctggactgctgggacgggcccgacggcaagccc
atcatctaccacggctggacgcggaccaccaagatcaagttcgacgacgttgtgcaggcc
atcaaagaccacgcctttgtcacctccagcttccctgtgatcctgtccatcgaggagcac
tgctgtgtggagcagcagcgccacatggccagggtgttcaaggaagtgtttggagacctg
ctgctgaccaaacctaaggaggccagtgccgaccagctgccgtcgcccagccagctgcgc
gggaagatcatcatcaagcataagaagctgggcccccgcggtgacgtggatgtcaacatg
gaggacaagaaggacgagcacaagcagcagggcgaactgcacatgtgggaccccatcgac
cagaaatggactcggcactactgtgccgttgctgatgccaagctgtccttcagcgatgac
attgaacagactgtggaagaggagctgcccctggatatacccccaacagagctgcatttt
ggggagaagtggttccacaagaaggtggagaagaggacaagtgccgagaagctgctgcag
gaatactgtgccgagacagggggcaaggatgggaccttcttggtgcgggagagtgagacc
ttccccaacgactacaccttgtccttctggcggtcgggccgcgtgcagcactgccggatc
cgctccaccatggagggcgggaccatgaagtactacctgaccgacaacctcatgttcacc
agcatctacgctctcatccagcactaccgcgagacacacctgcgctgcgccgagttcgag
ctccggctgaccgaccccgtgcccaaccccaacccgcacgagtccaagccgtggtactac
gatgggctgagccgtggagaagcggaggacatgctgatgcggatcccccgggatggggcc
ttcctgatccggaagcgggaaggtaccgactcctatgccatcaccttcagggccaggggc
aaggtgaagcactgtcgcatcaaccgagacggccggcacttcgtgctgggcacctccgcc
tacttcgagagccttgtggagctggtcagctactacgagaagcacgcactctaccggaag
atgaaactgcgctaccccgtgacccccgagctcctggagcgctacaacacggaaagagat
ataaactccctctacgatgtcagcaggatgtatgtggatcccagtgaaatcaatccttca
atgcctcagagaaccgtgaaagctctgtatgactacagggccaagcagagtgacgagctg
agcttttgccgcggtgccctcatccacaacgtctccaaggagcctgggggctggtggaaa
ggagactatgggaccagaatccagcagtacttcccgtccaattacgtcgaggacatttca
ccaacagaaggggaggaggtggataagcagattattgaagacaatcccttagggtccctt
tgcagaggaatcctgaatctcaacatctataatgttgtaaaagccccacatgggaagaac
cagaagcctttcgtctttatcttggagcccaagaagcagggcgaccctccggtagagttt
gccacggacagcgtggaggagctgtttgagtggttccagagcatccgggagatcacctgg
aagatggacgccaaggagaacaacatgaagtactgggagaagaaccagtccatcgccatc
gagctctcggacctggtcgtctactgcaagccaaccagcaagaccaaggacaacctcgaa
aaccctgacttccgagaaatccgctccttcgtggagacgaaggctgacagtatcgtcaga
cagaagcccagcgatctcctgaaatacaatcaaaagggcctgacccgtgtgtaccccaaa
ggacagcgggtggactcgtccaactatgaccccttccgcctctggctgtgcggctcccag
atggtggcactcaatttccagactccagataagtacatgcagatgaaccacgccctgttc
tccctcaacgggcggacgggctacgtcctgcagcctgagagcatgagggcggagaagtac
gaccccatgccacccgagtcccagaggaagatccagatgaccctgacggtcaaggtgctg
ggggcccgtcacctccccaagcccggccgcagcatcgcgtgccccttcgtggaggtggag
atatgcggagcggagtacgacagcaacaagtttaagacgacggttgtgaatgacaatggc
ctcagccctgtttggaccccaacgcaggagaaggtgacgtttgagatttatgaccccaac
cttgcgtttctgcgctttgtggtttatgaggaagatatgttcagcgatcccaactttctg
gcccatgccacgtaccccattaaaggaatcaagtcaggatttagatctgttcctctgaag
aacggctacagtgaagacattgagctggcgtccctcctggttttctgtgagatgcggcca
gtcctggtgagtggagaaacaccagtgggtgctcgcagagccacgtctgcggcggagggg
gggtga

DBGET integrated database retrieval system