KEGG   Bos mutus (wild yak): 102285873
Entry
102285873         CDS       T02919                                 

Gene name
TNFRSF1A
Definition
(RefSeq) TNF receptor superfamily member 1A
  KO
K03158  tumor necrosis factor receptor superfamily member 1A
Organism
bom  Bos mutus (wild yak)
Pathway
bom04010  MAPK signaling pathway
bom04060  Cytokine-cytokine receptor interaction
bom04061  Viral protein interaction with cytokine and cytokine receptor
bom04064  NF-kappa B signaling pathway
bom04071  Sphingolipid signaling pathway
bom04150  mTOR signaling pathway
bom04210  Apoptosis
bom04215  Apoptosis - multiple species
bom04217  Necroptosis
bom04380  Osteoclast differentiation
bom04668  TNF signaling pathway
bom04920  Adipocytokine signaling pathway
bom04931  Insulin resistance
bom04932  Non-alcoholic fatty liver disease
bom05010  Alzheimer disease
bom05014  Amyotrophic lateral sclerosis
bom05022  Pathways of neurodegeneration - multiple diseases
bom05132  Salmonella infection
bom05142  Chagas disease
bom05145  Toxoplasmosis
bom05152  Tuberculosis
bom05160  Hepatitis C
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05170  Human immunodeficiency virus 1 infection
bom05171  Coronavirus disease - COVID-19
bom05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102285873 (TNFRSF1A)
   04064 NF-kappa B signaling pathway
    102285873 (TNFRSF1A)
   04668 TNF signaling pathway
    102285873 (TNFRSF1A)
   04071 Sphingolipid signaling pathway
    102285873 (TNFRSF1A)
   04150 mTOR signaling pathway
    102285873 (TNFRSF1A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102285873 (TNFRSF1A)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102285873 (TNFRSF1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102285873 (TNFRSF1A)
   04215 Apoptosis - multiple species
    102285873 (TNFRSF1A)
   04217 Necroptosis
    102285873 (TNFRSF1A)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102285873 (TNFRSF1A)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102285873 (TNFRSF1A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102285873 (TNFRSF1A)
   05014 Amyotrophic lateral sclerosis
    102285873 (TNFRSF1A)
   05022 Pathways of neurodegeneration - multiple diseases
    102285873 (TNFRSF1A)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102285873 (TNFRSF1A)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102285873 (TNFRSF1A)
   04931 Insulin resistance
    102285873 (TNFRSF1A)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102285873 (TNFRSF1A)
   05152 Tuberculosis
    102285873 (TNFRSF1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102285873 (TNFRSF1A)
   05170 Human immunodeficiency virus 1 infection
    102285873 (TNFRSF1A)
   05160 Hepatitis C
    102285873 (TNFRSF1A)
   05171 Coronavirus disease - COVID-19
    102285873 (TNFRSF1A)
   05164 Influenza A
    102285873 (TNFRSF1A)
   05168 Herpes simplex virus 1 infection
    102285873 (TNFRSF1A)
   05163 Human cytomegalovirus infection
    102285873 (TNFRSF1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102285873 (TNFRSF1A)
   05165 Human papillomavirus infection
    102285873 (TNFRSF1A)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102285873 (TNFRSF1A)
   05142 Chagas disease
    102285873 (TNFRSF1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102285873 (TNFRSF1A)
   04090 CD molecules [BR:bom04090]
    102285873 (TNFRSF1A)
Cytokine receptors [BR:bom04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   102285873 (TNFRSF1A)
CD molecules [BR:bom04090]
 Proteins
  102285873 (TNFRSF1A)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 102285873
NCBI-ProteinID: XP_014337561
LinkDB
Position
Un
AA seq 364 aa
MGLPTVPGLLLPLVLPALLADVYPAGVQGLVPHPGDLEKRESPCPQGKYNHPQNSTICCT
KCHKGTYLYNDCPGPGRDTDCRVCAPGTYTALENHLRRCLSCSRCRDEMFQVEISPCVVD
RDTVCGCRKNQYREYWGETGFRCLNCSLCPNGTVNIPCQERQDTICHCHMGFFLKGAKCI
SCHDCKNKECEKLCPTRPSTGKDSQDPGTTVLLPLVIVFGLCLASFASVVLACRYQRWKP
KLYSIICGQSTLVKEGEPELLVPAPGFNPTTTICFNSTPSSSPVSIPPYISCDRSNFGAV
ASPSSETAPPHLKAGPILPGPPASTHLCTPGPPASTHLCTPVQKWEASAPSAPDQLASEP
RLLR
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgggcctccccaccgtgcctggcctgctgctgccactggtgcttccagctctgttggca
gatgtgtaccccgcaggggttcaggggctggtccctcaccccggggacctggagaagaga
gagagtccctgtccccaaggaaaatataaccacccgcaaaatagcaccatttgctgcacc
aagtgccacaaaggtacctatctgtacaatgactgtccgggtccagggcgagacacggac
tgcagggtgtgtgcccctggcacctacactgccttggagaaccatctcagacgatgcctg
agctgctccaggtgccgggacgaaatgttccaggtggagatttcgccttgtgtagtggac
cgggacactgtgtgcggctgcaggaagaaccagtaccgggaatactggggtgaaactggc
ttccggtgtctgaactgcagcctctgtcccaatggcacagtgaatatcccctgccaggag
agacaggacaccatctgccactgccatatgggcttctttcttaaaggcgccaagtgcatc
tcctgtcatgattgtaagaacaaggagtgcgagaagttatgtccaacccgaccttcaact
ggtaaagactctcaggacccaggcactacagtactattacccctggtgattgtcttcggg
ctttgcctggcatccttcgcctctgtcgtcttagcatgtcgctaccagcggtggaagccc
aagctctactccatcatttgcgggcagtcgactctggtaaaagagggggagccagaactc
ctggtcccggccccaggcttcaaccccaccaccaccatctgcttcaactccaccccaagt
tccagtcctgtctccattcccccttacatctcctgtgaccggtccaacttcggagccgtc
gcatctccctccagcgagacggccccgccccatctaaaagctggccccatcctcccgggg
cctccggcctccacccacctctgtaccccggggcctccggcctccacccacctctgcacc
ccagttcagaagtgggaagccagcgcccccagcgcccccgatcagctcgcgtccgagccc
cgccttctccggtga

DBGET integrated database retrieval system