KEGG   Bos mutus (wild yak): 102285914
Entry
102285914         CDS       T02919                                 

Gene name
EGF
Definition
(RefSeq) epidermal growth factor
  KO
K04357  epidermal growth factor
Organism
bom  Bos mutus (wild yak)
Pathway
bom01521  EGFR tyrosine kinase inhibitor resistance
bom04010  MAPK signaling pathway
bom04012  ErbB signaling pathway
bom04014  Ras signaling pathway
bom04015  Rap1 signaling pathway
bom04020  Calcium signaling pathway
bom04066  HIF-1 signaling pathway
bom04068  FoxO signaling pathway
bom04072  Phospholipase D signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04510  Focal adhesion
bom04540  Gap junction
bom04630  JAK-STAT signaling pathway
bom04810  Regulation of actin cytoskeleton
bom05160  Hepatitis C
bom05165  Human papillomavirus infection
bom05200  Pathways in cancer
bom05210  Colorectal cancer
bom05212  Pancreatic cancer
bom05213  Endometrial cancer
bom05214  Glioma
bom05215  Prostate cancer
bom05218  Melanoma
bom05219  Bladder cancer
bom05223  Non-small cell lung cancer
bom05224  Breast cancer
bom05226  Gastric cancer
bom05231  Choline metabolism in cancer
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102285914 (EGF)
   04012 ErbB signaling pathway
    102285914 (EGF)
   04014 Ras signaling pathway
    102285914 (EGF)
   04015 Rap1 signaling pathway
    102285914 (EGF)
   04630 JAK-STAT signaling pathway
    102285914 (EGF)
   04066 HIF-1 signaling pathway
    102285914 (EGF)
   04068 FoxO signaling pathway
    102285914 (EGF)
   04020 Calcium signaling pathway
    102285914 (EGF)
   04072 Phospholipase D signaling pathway
    102285914 (EGF)
   04151 PI3K-Akt signaling pathway
    102285914 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102285914 (EGF)
   04540 Gap junction
    102285914 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102285914 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102285914 (EGF)
   05231 Choline metabolism in cancer
    102285914 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102285914 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102285914 (EGF)
   05212 Pancreatic cancer
    102285914 (EGF)
   05226 Gastric cancer
    102285914 (EGF)
   05214 Glioma
    102285914 (EGF)
   05218 Melanoma
    102285914 (EGF)
   05219 Bladder cancer
    102285914 (EGF)
   05215 Prostate cancer
    102285914 (EGF)
   05213 Endometrial cancer
    102285914 (EGF)
   05224 Breast cancer
    102285914 (EGF)
   05223 Non-small cell lung cancer
    102285914 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102285914 (EGF)
   05165 Human papillomavirus infection
    102285914 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102285914 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102285914 (EGF)
Cytokines and growth factors [BR:bom04052]
 Growth factors
  Growth factors (RTK binding)
   102285914 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition cEGF EGF_CA EGF EGF_3 DUF5050
Other DBs
NCBI-GeneID: 102285914
NCBI-ProteinID: XP_014333855
LinkDB
Position
Un
AA seq 1212 aa
MLHFLVIVLLVVFKFSFVSLSALPHLNCPEGSPSGNGNSTCAGLVPFLIFSHGNSICRID
LEGMNYEQLVADAGISVIMDFHYNEERIYWVDLQRQLLQRVHLNGRRQEKVYNIDKNVSG
MAINWINEELIWSNQQEGIIIVTDMKGNNSWVLLSALKYPANIAVDPVASFMFWSSEVAX
SLHRADLGGMEVKLLLETSEKIAALSLDMLDKRLFWIQYHRGGGDPHICSCDYDGGSVLF
SKYSLRHNLLAESFFGDCIFYSTWKKNTIWIANKHTGKDMVKITLNSSFVPPSGIKVVRP
LVXPKAEGDAWASDQKLCKLKKGNCSSSMCEQXPKSQVCTCAEGYTLSQDGKNCKDVSEC
AFRNHGYTDDCENIPGSYYCTCPEGYVLLPDGKWCHQLISCPSNVSECSHDCVLTSDGPI
CSCPEGSVLDTDGKTCSGCSSPDNGGCSQPCTPLSPVSWKCGCLPGYDLQLDKKSHRSSG
PPPFLLFASSQDIRYMHFDGTDYGTLVHQQIIGMVFALDHDPVENKTVCLCSLLLIYFAH
TVLKWIERANMDASQRXRLIEEEVGLPEGLAVDWIGHKLYWTDRGKSLIEGSDLNGKYCE
IIIKEGISQPQGXAVHPMAKRLFWTDIGINPXIESSSLQGSGRLVIASSDLVWHSGIAVD
YLTDKLYWCDAKQSVIEMSNLDGSKCQRLPQKDVGHPFAVAVFEDHVWFSDWTMPSITRM
NKRTGKNSVRLPGSMLKPSSLLVVHPLAKPGADPCLHQNGGCEHICKERFETAQCLCHEG
FVKAPDGKMCLALHGHRILSDNMTNYNLSSEVLPLDVLAGSRELDYNMAESQHLPVAEIM
VSDLLRACKQKHMACGPFDIDTDYRSTWCFCLEVNLSQNLTKEVLECSIIKTDAMGCSTR
AECLSKGADVTCQCLKGFAGDGKQCSDVDGREMGLSVCPPTSPKCVNTEGGYVCWRSESY
QGDGIHCLDIDECRRGVHSCGENATXTNMEGNHTCTCAGDLSEPGQICPGYCLNGRVCIY
FGIANLFSCHCPIGYPGKRGEYIDFDGWDPHSAGRGHQWNTSPVAVRALVLAFLLLLGLC
RAHYYYRTQKWLLKNPKNPCEEPSRDVIRSRPADGEAGXPFCPQPWFVVVKEHQNLRNGS
PSEALKEGLAADVGQFSPLDPASLEQSSWRAEPQMYTGAEHGGCIASSNDRGSAHPLWQQ
RSPHQMELTLKT
NT seq 3639 nt   +upstreamnt  +downstreamnt
atgctgcatttccttgtcattgtgttgctggtagttttcaaatttagttttgttagcctc
tcagccctgccgcacttgaactgtcctgaaggctctccctctggaaacgggaattctact
tgtgcaggtcttgtgccctttttaattttttcccatggaaatagtatctgtaggattgat
ttggaaggaatgaattatgaacaattggtggcagatgctggcatctcagtgatcatggat
tttcattacaatgaagaaagaatctattgggttgatctacaaagacaactcttgcaaaga
gttcatttgaatgggagaaggcaagagaaagtatacaatatagataaaaatgtttcagga
atggcaataaattggatcaatgaagaacttatttggtctaatcaacaggaaggaatcatt
atagtaactgatatgaaaggaaacaattcctgggttctcttaagtgccttaaaatatcct
gcaaatatagcagttgatccagtagcaagttttatgttttggtcttcagaggtggctngc
agccttcacagagcagatcttggtggtatggaagtgaagcttctgttagagacatcagag
aaaatagcagctctatcattggatatgcttgataaacggctcttttggattcagtaccat
agaggaggaggtgatcctcatatttgttcctgtgattatgacgggggttctgtccttttt
agcaaatattccctgcggcacaatctgcttgcagagtccttctttggagactgtatcttc
tattcaacatggaaaaagaacacaatttggatagctaacaagcacacagggaaggatatg
gttaaaatcaccctcaactcgtcattcgtgccacccagtggaattaaagtggttcgtcca
ctcgtatagcccaaggcagagggtgatgcttgggcatctgatcagaaactctgcaaactg
aagaaaggtaactgcagcagcagcatgtgtgaacaatagcctaagtcccaagtgtgcacg
tgtgcagagggatacactttaagccaagatggaaagaactgtaaagatgtcagtgagtgt
gcttttcggaatcatggctacacagatgactgtgaaaatatccctggatcctattactgc
acatgccctgagggatatgtcctgcttcctgatgggaaatggtgtcaccagttaatttcc
tgcccaagcaatgtgtctgaatgcagtcatgactgtgttctgacatcagacggtcccata
tgttcctgtcctgaaggctcagtgcttgacacagatggaaagacatgcagtggctgttca
tcacctgataatgggggatgtagccagccctgcacccctctcagccccgtatcctggaaa
tgtggctgccttcctgggtatgacctacaactggacaaaaagagccatagatcttcagga
ccaccaccatttttgctgtttgccagttctcaagacattcgatacatgcattttgatgga
acagattatggaaccctggtccaccaacaaataataggaatggtttttgcccttgatcat
gaccctgtggaaaataagactgtatgcctgtgttctcttttgttgatatactttgcccat
acagtcctgaagtggatagaaagagctaatatggatgcttcccagcgangaaggcttatc
gaggaagaagtaggtttaccagaaggtcttgctgttgactggattggccataaactctac
tggacagacagagggaaatctctcattgaagggagtgatttaaatggaaagtattgtgaa
ataatcattaaggagggcatctctcagccacaagganatgctgttcatccaatggccaag
agattattctggactgatataggaattaatccatgaattgaaagttcttctcttcaaggc
agtggccgactggttatagctagctccgatctagtctggcacagtggaatagcagttgat
tacttaactgacaagttgtattggtgcgatgccaagcagtctgtgattgaaatgtccaat
ctggatggctcaaaatgccaaagacttccccagaaggatgtgggtcacccatttgccgtg
gctgtgtttgaggatcacgtatggttctctgattggactatgccatcgataacaaggatg
aacaagaggactggcaaaaatagcgtacgtctcccaggcagcatgctgaagccctcatct
ctgcttgtagttcatccattggcaaaaccaggagcagatccctgcttacatcaaaatgga
ggctgtgaacatatttgcaaagagaggtttgaaactgctcagtgtttgtgtcatgaaggt
tttgtgaaagctccagatggaaaaatgtgtctggctcttcatggccatcggatattgtca
gataatatgacaaactacaatctgagtagtgaagtcctgccactggacgtcttagccggc
agcagagagcttgactataacatggcagagtctcaacacctgccagtggccgagatcatg
gtgtcagatttgttgagagcatgtaaacagaagcatatggcttgtggaccctttgatata
gatacagattacagatcaacatggtgtttctgtttggaggttaacctgtcccagaacttg
acaaaagaagttctagaatgttctataataaagactgatgccatgggatgcagtacacgg
gctgagtgcctttcaaagggagcagatgtcacatgtcagtgtttgaaaggatttgctgga
gatggaaaacaatgttctgatgtagatggacgtgagatgggtctctcagtttgccctccc
acctcccccaagtgtgtcaatacagaaggcggctatgtctgctggcgctcagagagctac
cagggagatggaatccactgtttggatattgatgagtgccgacggggcgtgcacagctgt
ggggaaaatgccacctgaacaaatatggagggaaaccacacttgcacgtgtgctggcgac
ttgtctgagcctggacagatttgccctgggtactgcctcaatggtcgtgtctgtatatat
tttggcattgccaacctgttctcctgccactgtcccattggctaccctgggaagcgaggt
gagtacatagacttcgatgggtgggatccgcacagtgcgggccgtgggcatcagtggaac
accagcccggtggctgtccgtgcactggtgctggctttcctgctgctcctcgggctgtgc
agagctcactactactacaggactcagaagtggctactgaaaaatccaaagaatccttgt
gaagaaccgagcagagatgtgatccgtagcaggcctgcagatggcgaggctggantgcct
ttttgcccccaaccttggttcgtggttgtaaaggaacatcaaaacctcaggaatgggagt
ccatctgaggccctcaaggaaggcctggcagcagatgttggccagttttcccccctggat
cctgcgtccttggaacagtcatcatggagagcggagccccagatgtatacgggcgcagaa
cacggaggctgtattgcgtcatccaacgatagaggctctgctcaccctttgtggcaacaa
agatctccacaccaaatggagctgactctgaaaacttga

DBGET integrated database retrieval system