KEGG   Bos mutus (wild yak): 102285922Help
Entry
102285922         CDS       T02919                                 

Gene name
ELOVL1
Definition
(RefSeq) ELOVL fatty acid elongase 1
  KO
K10247  elongation of very long chain fatty acids protein 1 [EC:2.3.1.199]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00062  Fatty acid elongation
bom01040  Biosynthesis of unsaturated fatty acids
bom01100  Metabolic pathways
bom01212  Fatty acid metabolism
Module
bom_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    102285922 (ELOVL1)
   01040 Biosynthesis of unsaturated fatty acids
    102285922 (ELOVL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bom01004]
    102285922 (ELOVL1)
Enzymes [BR:bom01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     102285922 (ELOVL1)
Lipid biosynthesis proteins [BR:bom01004]
 Elongase
  PUFA
   102285922 (ELOVL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ELO
Motif
Other DBs
NCBI-GeneID: 102285922
NCBI-ProteinID: XP_005898423
LinkDB All DBs
Position
Un
AA seq 314 aa AA seqDB search
MRKWQAGWPWGLLSSLAPSQPSTTARLAPTEPLARMEAIVNLYQEMMKHADPRVQGYPLM
ESPLLMTSILLTYVYFVLSLGPRIMANRKPFQLRGFMVVYNFSLVALSLYIVYEFLMSGW
LSSYTWRCDPVDFSNNPEALRMVRVAWLFLFSKFIELIDTLIFVLRKKDGQVTFLHVFHH
SVLPWSWWWGVKIAPGGMGSFHAMINSSVHVVMYLYYGLSALGPVAQPYLWWKKHMTAIQ
LIQFVLVSLHISQYYFLPSCNYQYPVIIHLIWMYGTIFFVLFSNFWYQSYTKGKRLPRVS
QQNGVPGTTKVKAN
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagtggcaggcaggctggccctggggactgctctccagccttgctccatcccag
ccctccacgactgcccgcctggcccccactgagcccttagcgaggatggaggctattgtg
aacctgtaccaggagatgatgaagcatgcagatccccgggtccagggctaccctctgatg
gagtcccccctgctaatgacctccatcctcctgacctatgtatacttcgttctctcactg
ggccctcgcatcatggccaaccggaagcccttccagctccgtggcttcatggttgtctac
aacttctcactggtggcactttctctctacattgtctatgagttcctgatgtctggctgg
ctaagttcctacacctggcgctgcgacccagtggacttttccaacaacccggaggcactg
aggatggttcgagtggcctggctcttcctcttctccaagttcattgagctgatagataca
ctgatctttgttctccggaagaaagacggacaggtgaccttcctacatgtcttccatcac
tcagtgcttccctggagctggtggtggggggtaaaaatagccccaggaggaatgggctct
ttccacgccatgatcaactcctctgtgcacgtcgtcatgtacctgtactatggattgtct
gcccttgggcctgtggctcagccctacctttggtggaaaaagcacatgacagccatccag
ctgatccagtttgtcctggtctcgctgcacatctcccaatactacttcctgcccagttgt
aactaccagtacccagtcatcatccacctcatctggatgtacggcaccatcttcttcgtg
ctcttctccaatttctggtatcagtcttacactaaaggcaagcggctgccccgtgtatct
cagcaaaacggagttccaggtaccaccaaagtcaaggccaactga

DBGET integrated database retrieval system